Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE PERIPLASMIC CHAPERONE SFAE
 
Authors :  S. D. Knight, D. Choudhury, S. Hultgren, J. Pinkner, V. Stojanoff, A. Thompson
Date :  05 Mar 02  (Deposition) - 12 Jun 02  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Periplasmic Chaperone, Immunoglobulin Fold (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. D. Knight, D. Choudhury, S. Hultgren, J. Pinkner, V. Stojanoff, A. Thompson
Structure Of The S Pilus Periplasmic Chaperone Sfae At 2. 2 A Resolution.
Acta Crystallogr. , Sect. D V. 58 1016 2002
PubMed-ID: 12037304  |  Reference-DOI: 10.1107/S0907444902005954
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - SFAE PROTEIN
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PJP12
    Expression System Strain: C600
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Organism Scientific: ESCHERICHIA COLI
    Organism Taxid: 562

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1L4I)

(-) Sites  (0, 0)

(no "Site" information available for 1L4I)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1L4I)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Thr A:51 -Pro A:52
2Thr B:51 -Pro B:52

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1L4I)

(-) PROSITE Motifs  (1, 2)

Asymmetric/Biological Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PILI_CHAPERONEPS00635 Gram-negative pili assembly chaperone signature.FOCC_ECOLX96-113
 		  2A:75-92
B:75-92

(-) Exons   (0, 0)

(no "Exon" information available for 1L4I)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:189
 aligned with FOCC_ECOLX | P62609 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:205
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221     
           FOCC_ECOLX    22 GVALGATRVIYPEGQKQVQLAVTNNDDKSSYLIQSWIENAEGKKDARFVITPPLFSMQGKKENTLRIIDATNGQMPEDRESLFWVNVKAIPAMDKAKTGENYLQFAIVSRIKLLYRPQGLVIPPEQAPGKLEFTRENGGLTLFNPTPYYLTVTDLKAGNKSLENTMVPPQGKVTVNIPGGYTGGDITYKTINDYGALTEQVKGVV 226
               SCOP domains d1l4ia1 A:1-120 Periplasmic chaperone SfaE                                                                              d1l4ia2 A:121-20   5 SfaE                                                             SCOP domains
               CATH domains -1l4iA01 A:2-118 PapD-like                                                                                            ---1l4iA02 A:122-2   02  [code=2.60.40.1070, no name define     d]                  --- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee...eeeee....eeeeeeee.....eeeeeeeeee........eeee..eeeee..eeeeeeeee...........eeeeeeeeeee...--------...eeeeeeeeeee......hhhhhhhhheee..---.eee......eeeeeeee..ee...eee....eee...-----...eeeeee.........eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------PILI_CHAPERONE    ----------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1l4i A   1 GVALGATRVIYPEGQKQVQLAVTNNDDKSSYLIQSWIENAEGKKDARFVITPPLFSMQGKKENTLRIIDATNGQMPEDRESLFWVNVKAIPAMD--------LQFAIVSRIKLLYRPQGLVIPPEQAPGKLEFTRE---LTLFNPTPYYLTVTDLKAGNKSLENTMVPPQGKVTVNI-----GGDITYKTINDYGALTEQVRGVV 205
                                    10        20        30        40        50        60        70        80        90   |     -  |    110       120       130     | 140       150       160       170      |  -  |    190       200     
                                                                                                                        94      103                              136 140                                  177   183                      


Chain B from PDB  Type:PROTEIN  Length:189
 aligned with FOCC_ECOLX | P62609 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:206
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221      
           FOCC_ECOLX    22 GVALGATRVIYPEGQKQVQLAVTNNDDKSSYLIQSWIENAEGKKDARFVITPPLFSMQGKKENTLRIIDATNGQMPEDRESLFWVNVKAIPAMDKAKTGENYLQFAIVSRIKLLYRPQGLVIPPEQAPGKLEFTRENGGLTLFNPTPYYLTVTDLKAGNKSLENTMVPPQGKVTVNIPGGYTGGDITYKTINDYGALTEQVKGVVK 227
               SCOP domains d1l4ib1 B:1-120 Periplasmic chaperone SfaE                                                                              d1l4ib2 B:121-20   6 SfaE                                                              SCOP domains
               CATH domains -1l4iB01 B:2-118 PapD-like                                                                                            ---1l4iB02 B:122-2   03  [code=2.60.40.1070, no name defined]                        --- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee...eeeee.....eeeeeee.....eeeeeeeeee........eeee..eeeee..eeeeeeeee...........eeeeeeeeeee..----------...eeeeeeeeee......hhhhhhhh.eee..---.eee......eeeeeeee..ee...eee....eee......----.eeeee..........ee.eee Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------PILI_CHAPERONE    ------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1l4i B   1 GVALGATRVIYPEGQKQVQLAVTNNDDKSSYLIQSWIENAEGKKDARFVITPPLFSMQGKKENTLRIIDATNGQMPEDRESLFWVNVKAIPAM----------QFAIVSRIKLLYRPQGLVIPPEQAPGKLEFTRE---LTLFNPTPYYLTVTDLKAGNKSLENTMVPPQGKVTVNIPGG----DITYKTINDYGALTEQVRGVVK 206
                                    10        20        30        40        50        60        70        80        90  |      -   |   110       120       130     | 140       150       160       170       180    |  190       200      
                                                                                                                       93        104                             136 140                                     180  185
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1L4I)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (FOCC_ECOLX | P62609)
biological process
    GO:0071555    cell wall organization    A process that results in the assembly, arrangement of constituent parts, or disassembly of the cell wall, the rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal and most prokaryotic cells, maintaining their shape and protecting them from osmotic lysis.
    GO:0061077    chaperone-mediated protein folding    The process of inhibiting aggregation and assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure that is dependent on interaction with a chaperone.
    GO:0043711    pilus organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a pilus, a short filamentous structure on a bacterial cell, flagella-like in structure and generally present in many copies.
cellular component
    GO:0030288    outer membrane-bounded periplasmic space    The region between the inner (cytoplasmic or plasma) membrane and outer membrane of organisms with two membranes such as Gram negative bacteria. These periplasmic spaces are relatively thick and contain a thin peptidoglycan layer (PGL), also referred to as a thin cell wall.
    GO:0042597    periplasmic space    The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1l4i)
 
  Sites
(no "Sites" information available for 1l4i)
 
  Cis Peptide Bonds
    Thr A:51 - Pro A:52   [ RasMol ]  
    Thr B:51 - Pro B:52   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1l4i
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FOCC_ECOLX | P62609
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  FOCC_ECOLX | P62609
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1L4I)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1L4I)