Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURAL GENOMICS, PROTEIN TM1243, (SAICAR SYNTHETASE)
 
Authors :  R. Zhang, T. Skarina, S. Beasley, A. Edwards, A. Joachimiak, A. Savchenko, Midwest Center For Structural Genomics (Mcsg)
Date :  22 Jan 02  (Deposition) - 14 Aug 02  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Saicar Synthetase, Psi, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Ligase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Zhang, T. Skarina, E. Evdokimova, A. Edwards, A. Savchenko, R. Laskowski, M. E. Cuff, A. Joachimiak
Structure Of Saicar Synthase From Thermotoga Maritima At 2. 2 Angstroms Reveals An Unusual Covalent Dimer.
Acta Crystallogr. , Sect. F V. 62 335 2006
PubMed-ID: 16582479  |  Reference-DOI: 10.1107/S1744309106009651
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE SYNTHASE
    Chains: A, B
    EC Number: 6.3.2.6
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET15B
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: TM1243
    Organism Scientific: THERMOTOGA MARITIMA
    Organism Taxid: 2336
    Synonym: SAICAR SYNTHETASE

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 8)

Asymmetric/Biological Unit (1, 8)
No.NameCountTypeFull Name
1MSE8Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1KUT)

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:126 -B:126

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Pro A:68 -Pro A:69
2Pro B:68 -Pro B:69

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1KUT)

(-) PROSITE Motifs  (1, 2)

Asymmetric/Biological Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SAICAR_SYNTHETASE_1PS01057 SAICAR synthetase signature 1.PUR7_THEMA79-93
 		  2A:79-93
B:79-93

(-) Exons   (0, 0)

(no "Exon" information available for 1KUT)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:213
 aligned with PUR7_THEMA | Q9X0X0 from UniProtKB/Swiss-Prot  Length:230

    Alignment length:224
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226    
           PUR7_THEMA     7 TKIVKVTGDYALLEFKDDITAGDGLKHDVLTGKGSICAETTAILMKYLSEKGIKTHLVEYIPPRTLKVIPLKMFPLEVVVRLKKAGSFVRRYGGAEGEDLPVPLVEFFIKDDERHDPMVCVDHLEILGIATKKQAEKMKEAAVKITLALKEFFERANFELWDIKYEFGLDKDGNVVLGDEISPDTFRLRKKGEIFDKDVYRRDLGDPLKKYREVLELCRSLNSQ 230
               SCOP domains d1kuta_ A: SAICAR            synthase                                                                                                                                                                                            SCOP domains
               CATH domains 1kutA01 A:7-77 Pho           sphorylase Kinase; domain 1               1kutA02 A:78-210 ATP-grasp fold, B domain                                                                                            -------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee..eeeeee...-----------..hhhhhhhhhhhhhhhhhhhh.....eeeee...eeee...ee..eeeeeeee.hhhhhhhhh.....eeeeeeeeeee.hhhhh....hhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeeee.eee.....eee........eeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------SAICAR_SYNTHETA----------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1kut A   7 TKIVKVTGDYALLEFKDD-----------LTGKGSICAETTAILmKYLSEKGIKTHLVEYIPPRTLKVIPLKmFPLEVVVRLKKAGSFVRRYGGAEGEDLPVPLVEFFIKDDERHDPmVCVDHLEILGIATKKQAEKmKEAAVKITLALKEFFERANFELWDIKYEFGLDKDGNVVLGDEISPDTFRLRKKGEIFDKDVYRRDLGDPLKKYREVLELCRSLNSQ 230
                                    16       | -        36        46    |   56        66        76  |     86        96       106       116       126       136       146       156       166       176       186       196       206       216       226    
                                            24          36             51-MSE                      79-MSE                                      124-MSE             144-MSE                                                                                  


Chain B from PDB  Type:PROTEIN  Length:222
 aligned with PUR7_THEMA | Q9X0X0 from UniProtKB/Swiss-Prot  Length:230

    Alignment length:229
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221         
           PUR7_THEMA     2 NYEGKTKIVKVTGDYALLEFKDDITAGDGLKHDVLTGKGSICAETTAILMKYLSEKGIKTHLVEYIPPRTLKVIPLKMFPLEVVVRLKKAGSFVRRYGGAEGEDLPVPLVEFFIKDDERHDPMVCVDHLEILGIATKKQAEKMKEAAVKITLALKEFFERANFELWDIKYEFGLDKDGNVVLGDEISPDTFRLRKKGEIFDKDVYRRDLGDPLKKYREVLELCRSLNSQ 230
               SCOP domains d1kutb_ B: SAICAR synthas     e                                                                                                                                                                                                       SCOP domains
               CATH domains 1kutB01 B:2-77,B:213-230      Phosphorylase Kinase; domain 1                1kutB02 B:78-212 ATP-grasp fold, B domain                                                                                              1kutB01            CATH domains
           Pfam domains (1) SAICAR_synt-1kutB01 B:2-2     27                                                                                                                                                                                                  --- Pfam domains (1)
           Pfam domains (2) SAICAR_synt-1kutB02 B:2-2     27                                                                                                                                                                                                  --- Pfam domains (2)
         Sec.struct. author .ee...eeeeee..eeeeee.....-----......hhhhhhhhhhhhhhhhhhh......eeeee...eeee...ee..eeeeeeee..hhhhhhhh.....eeeeeeeeeee........eehhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeeee.eee.....eee........eeeee..--hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------SAICAR_SYNTHETA----------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1kut B   2 NYEGKTKIVKVTGDYALLEFKDDIT-----KHDVLTGKGSICAETTAILmKYLSEKGIKTHLVEYIPPRTLKVIPLKmFPLEVVVRLKKAGSFVRRYGGAEGEDLPVPLVEFFIKDDERHDPmVCVDHLEILGIATKKQAEKmKEAAVKITLALKEFFERANFELWDIKYEFGLDKDGNVVLGDEISPDTFRLRKKG--FDKDVYRRDLGDPLKKYREVLELCRSLNSQ 230
                                    11        21    |    -|       41        51        61        71       |81        91       101       111       121  |    131       141  |    151       161       171       181       191      |201       211       221         
                                                   26    32                 51-MSE                      79-MSE                                      124-MSE             144-MSE                                               198  |                             
                                                                                                                                                                                                                                 201
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: no clan defined [family: SAICAR_synt] (7)

(-) Gene Ontology  (9, 9)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (PUR7_THEMA | Q9X0X0)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0016874    ligase activity    Catalysis of the joining of two substances, or two groups within a single molecule, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0004638    phosphoribosylaminoimidazole carboxylase activity    Catalysis of the reaction: 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxylate + 2 H(+) = 5-amino-1-(5-phospho-D-ribosyl)imidazole + CO(2).
    GO:0004639    phosphoribosylaminoimidazolesuccinocarboxamide synthase activity    Catalysis of the reaction: 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxylate + L-aspartate + ATP = (2S)-2-[5-amino-1-(5-phospho-beta-D-ribosyl)imidazole-4-carboxamido]succinate + ADP + 2 H(+) + phosphate.
biological process
    GO:0006189    'de novo' IMP biosynthetic process    The chemical reactions and pathways resulting in the formation of IMP, inosine monophosphate, by the stepwise assembly of a purine ring on ribose 5-phosphate.
    GO:0046084    adenine biosynthetic process    The chemical reactions and pathways resulting in the formation of adenine, 6-aminopurine, one of the five main bases found in nucleic acids and a component of numerous important derivatives of its corresponding ribonucleoside, adenosine.
    GO:0006164    purine nucleotide biosynthetic process    The chemical reactions and pathways resulting in the formation of a purine nucleotide, a compound consisting of nucleoside (a purine base linked to a deoxyribose or ribose sugar) esterified with a phosphate group at either the 3' or 5'-hydroxyl group of the sugar.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1kut)
 
  Cis Peptide Bonds
    Pro A:68 - Pro A:69   [ RasMol ]  
    Pro B:68 - Pro B:69   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1kut
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PUR7_THEMA | Q9X0X0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  6.3.2.6
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  PUR7_THEMA | Q9X0X0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1KUT)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1KUT)