1KQ6 - JenaLib

Asymmetric Unit (13, 13)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	HIS A:51 , LYS A:52 , LYS A:55 , ARG A:70 , HIS A:74 , LEU A:75 , HOH A:1065	BINDING SITE FOR RESIDUE SO4 A 301
02	AC2	SOFTWARE	ARG A:7 , HIS A:8 , LYS A:31 , HIS A:113 , ASP A:116 , HOH A:1008 , HOH A:1015 , HOH A:1029	BINDING SITE FOR RESIDUE SO4 A 302
03	AC3	SOFTWARE	ARG A:43 , PHE A:44 , THR A:45 , ASP A:82 , GLY A:83 , HOH A:1012 , HOH A:1025	BINDING SITE FOR RESIDUE SO4 A 303
04	AC4	SOFTWARE	PHE A:5 , ILE A:6 , ARG A:7 , MSE A:102 , SER A:109 , ARG A:110 , GOL A:202 , HOH A:1028 , HOH A:1100	BINDING SITE FOR RESIDUE GOL A 201
05	AC5	SOFTWARE	THR A:4 , ARG A:7 , PRO A:112 , LEU A:115 , ASP A:116 , LYS A:119 , GOL A:201 , HOH A:1028 , HOH A:1100 , HOH A:1102	BINDING SITE FOR RESIDUE GOL A 202
06	AC6	SOFTWARE	GLY A:2 , PHE A:5 , ARG A:7 , ARG A:110 , HOH A:1100 , HOH A:1126 , HOH A:1154	BINDING SITE FOR RESIDUE GOL A 203
07	AC7	SOFTWARE	TRP A:32 , GLN A:33 , ASP A:34 , LYS A:38 , LYS A:119 , GOL A:206 , HOH A:1006 , HOH A:1143 , HOH A:1148	BINDING SITE FOR RESIDUE GOL A 204
08	AC8	SOFTWARE	HIS A:74 , THR A:100 , LYS A:107 , HOH A:1017 , HOH A:1049 , HOH A:1054 , HOH A:1071 , HOH A:1122	BINDING SITE FOR RESIDUE GOL A 205
09	AC9	SOFTWARE	LYS A:119 , LYS A:134 , GOL A:204 , GOL A:207 , HOH A:1026 , HOH A:1143	BINDING SITE FOR RESIDUE GOL A 206
10	BC1	SOFTWARE	ARG A:7 , ASP A:116 , LYS A:119 , LYS A:134 , LYS A:135 , PRO A:136 , GOL A:206 , HOH A:1073	BINDING SITE FOR RESIDUE GOL A 207
11	BC2	SOFTWARE	GLU A:37 , VAL A:39 , ASP A:124 , LEU A:125 , GOL A:209 , HOH A:1046 , HOH A:1137	BINDING SITE FOR RESIDUE GOL A 208
12	BC3	SOFTWARE	SER A:36 , LYS A:38 , LEU A:125 , GOL A:208 , HOH A:1046 , HOH A:1062 , HOH A:1081 , HOH A:1137	BINDING SITE FOR RESIDUE GOL A 209
13	BC4	SOFTWARE	PRO A:20	BINDING SITE FOR RESIDUE GOL A 210

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (3, 3)

PROSITE Motifs (1, 1)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:140
 aligned with NCF1_HUMAN | P14598 from UniProtKB/Swiss-Prot  Length:390

    Alignment length:140
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141
           NCF1_HUMAN     2 GDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCGTLMSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETYLM 141
               SCOP domains d1kq6a_ A: p47phox NADPH oxidase                                                                                                             SCOP domains
               CATH domains 1kq6A00 A:2-140 PX Domain                                                                                                                  - CATH domains
               Pfam domains --PX-1kq6A01 A:4-121                                                                                                    -------------------- Pfam domains
         Sec.struct. author ....eeeeeeeeeeee.....eeeeeeeeee....eeeeeehhhhhhhhhhhhhhhh.......hhhhh............hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhh..........eeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------Q-----------------------------------------------H--------S------------------------------------------ SAPs(SNPs)
                    PROSITE --PX  PDB: A:4-125 UniProt: 4-125                                                                                           ---------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1kq6 A   2 GDTFIRHIALLGFEKRFVPSQHYVYmFLVKWQDLSEKVVYRRFTEIYEFHKTLKEmFPIEAGAINPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCSTLmSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETYLm 141
                                    11        21     |  31        41        51     |  61        71        81        91       101|      111       121       131       141
                                                    27-MSE                        57-MSE                                      102-MSE                                141-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (23, 23)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (NCF1_HUMAN | P14598)

molecular function
	GO:0017124	SH3 domain binding	Interacting selectively and non-covalently with a SH3 domain (Src homology 3) of a protein, small protein modules containing approximately 50 amino acid residues found in a great variety of intracellular or membrane-associated proteins.
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0008289	lipid binding	Interacting selectively and non-covalently with a lipid.
	GO:0035091	phosphatidylinositol binding	Interacting selectively and non-covalently with any inositol-containing glycerophospholipid, i.e. phosphatidylinositol (PtdIns) and its phosphorylated derivatives.
	GO:0043325	phosphatidylinositol-3,4-bisphosphate binding	Interacting selectively and non-covalently with phosphatidylinositol-3,4-bisphosphate, a derivative of phosphatidylinositol in which the inositol ring is phosphorylated at the 3' and 4' positions.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0016175	superoxide-generating NADPH oxidase activity	Catalysis of the reaction: NAD(P)H + O2 = NAD(P)H + O2-.
biological process
	GO:0002479	antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	The process in which an antigen-presenting cell expresses a peptide antigen of exogenous origin on its cell surface in association with an MHC class I protein complex following intracellular transport via a TAP (transporter associated with antigen processing) pathway. The peptide is typically a fragment of a larger exogenous protein which has been degraded within the cell and is dependent on TAP transport from the cytosol to ER for association with the MHC class I molecule. Class I here refers to classical class I molecules.
	GO:0045454	cell redox homeostasis	Any process that maintains the redox environment of a cell or compartment within a cell.
	GO:0006968	cellular defense response	A defense response that is mediated by cells.
	GO:0045087	innate immune response	Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0006612	protein targeting to membrane	The process of directing proteins towards a membrane, usually using signals contained within the protein.
	GO:0045730	respiratory burst	A phase of elevated metabolic activity, during which oxygen consumption increases; this leads to the production, by an NADH dependent system, of hydrogen peroxide (H2O2), superoxide anions and hydroxyl radicals.
	GO:0042554	superoxide anion generation	The enzymatic generation of superoxide, the superoxide anion O2- (superoxide free radical), or any compound containing this species, by a cell in response to environmental stress, thereby mediating the activation of various stress-inducible signaling pathways.
	GO:0006801	superoxide metabolic process	The chemical reactions and pathways involving superoxide, the superoxide anion O2- (superoxide free radical), or any compound containing this species.
	GO:0048010	vascular endothelial growth factor receptor signaling pathway	Any series of molecular signals initiated by the binding of an extracellular ligand to a vascular endothelial growth factor receptor (VEGFR) located on the surface of the receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
	GO:0043020	NADPH oxidase complex	A enzyme complex of which the core is a heterodimer composed of a light (alpha) and heavy (beta) chain, and requires several other water-soluble proteins of cytosolic origin for activity. Functions in superoxide generation by the NADPH-dependent reduction of O2.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0019898	extrinsic component of membrane	The component of a membrane consisting of gene products and protein complexes that are loosely bound to one of its surfaces, but not integrated into the hydrophobic region.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0032010	phagolysosome	A membrane-bounded intracellular vesicle formed by maturation of an early phagosome following the ingestion of particulate material by phagocytosis; during maturation, phagosomes acquire markers of late endosomes and lysosomes.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]
		BC2	[ RasMol ]	+environment [ RasMol ]
		BC3	[ RasMol ]	+environment [ RasMol ]
		BC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Val A:19 - Pro A:20	[ RasMol ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1kq6
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	NCF1_HUMAN \| P14598
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	233700
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 17)

Sites (13, 13)