Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  HPR KINASE/PHOSPHATASE FROM MYCOPLASMA PNEUMONIAE
 
Authors :  G. S. Allen
Date :  19 Dec 01  (Deposition) - 31 Dec 02  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F
Keywords :  Hpr Kinase, Hpr Kinase/Phosphatase, Hprk/P, Kinase, Phosphatase, P-Loop, Walker A Box, Catabolite Repression, Transferase/Hydrolase Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  G. S. Allen, K. Steinhauer, W. Hillen, J. Stulke, R. G. Brennan
Crystal Structure Of Hpr Kinase/Phosphatase From Mycoplasma Pneumoniae
J. Mol. Biol. V. 326 1203 2003
PubMed-ID: 12589763  |  Reference-DOI: 10.1016/S0022-2836(02)01378-5
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROBABLE HPR(SER) KINASE/PHOSPHATASE
    Chains: A, B, C, D, E, F
    EC Number: 2.7.1.-, 3.1.3.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Organism Scientific: MYCOPLASMA PNEUMONIAE
    Organism Taxid: 2104

 Structural Features

(-) Chains, Units

  123456
Asymmetric/Biological Unit : ABCDEF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1KNX)

(-) Sites  (0, 0)

(no "Site" information available for 1KNX)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1KNX)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1KNX)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1KNX)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1KNX)

(-) Exons   (0, 0)

(no "Exon" information available for 1KNX)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:303
 aligned with HPRK_MYCPN | P75548 from UniProtKB/Swiss-Prot  Length:312

    Alignment length:309
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300         
           HPRK_MYCPN     1 MKKLLVKELIEQFQDCVNLIDGHTNTSNVIRVPGLKRVVFEMLGLFSSQIGSVAILGKREFGFLSQKTLVEQQQILHNLLKLNPPAIILTKSFTDPTVLLQVNQTYQVPILKTDFFSTELSFTVETYINEQFATVAQIHGVLLEVFGVGVLLTGRSGIGKSECALDLINKNHLFVGDDAIEIYRLGNRLFGRAQEVAKKFMEIRGLGIINVERFYGLQITKQRTEIQLMVNLLSLEKQTTVTFERLGTELKKQRLLGVDLSFYEIPISPGRKTSEIIESAVIDFKLKHSGYNSALDFIENQKAILKRKK 309
               SCOP domains d1knxa1 A:1-132 HPr kinase/phoshatase HprK N-terminal domain                                                                        d1knxa2 A:133-309 HPr kinase HprK C-terminal domain                                                                                                                               SCOP domains
               CATH domains 1knxA01 A:1-133  [code=3.40.1390.20, no name defined]                                                                                1knxA02 A:134-308 P-loop containing nucleotide triphosphate hydrolases                                                                                                         - CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhh..........................hhhhhh..........eeehhhhhhhhh..hhhhhh.hhhhhhh.....eeee.....hhhhhhhhhhh...eeee..hhhhhh.hhhhhhhhhh...eeeeeeeeee..eeeeeee....hhhhhhhhhhh...eeeeeeeeeeeee..eeeeee......eeee...eeeehhhhhhhhhh...eeeeeeeeee..------..........eeee..eeeeeeeee.....hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1knx A   1 MKKLLVKELIEQFQDCVNLIDGHTNTSNVIRVPGLKRVVFEMLGLFSSQIGSVAILGKREFGFLSQKTLVEQQQILHNLLKLNPPAIILTKSFTDPTVLLQVNQTYQVPILKTDFFSTELSFTVETYINEQFATVAQIHGVLLEVFGVGVLLTGRSGIGKSECALDLINKNHLFVGDDAIEIYRLGNRLFGRAQEVAKKFMEIRGLGIINVERFYGLQITKQRTEIQLMVNLLSL------TFERLGTELKKQRLLGVDLSFYEIPISPGRKTSEIIESAVIDFKLKHSGYNSALDFIENQKAILKRKK 309
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230    |    - |     250       260       270       280       290       300         
                                                                                                                                                                                                                                                                    235    242                                                                   


Chain B from PDB  Type:PROTEIN  Length:304
 aligned with HPRK_MYCPN | P75548 from UniProtKB/Swiss-Prot  Length:312

    Alignment length:308
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300        
           HPRK_MYCPN     1 MKKLLVKELIEQFQDCVNLIDGHTNTSNVIRVPGLKRVVFEMLGLFSSQIGSVAILGKREFGFLSQKTLVEQQQILHNLLKLNPPAIILTKSFTDPTVLLQVNQTYQVPILKTDFFSTELSFTVETYINEQFATVAQIHGVLLEVFGVGVLLTGRSGIGKSECALDLINKNHLFVGDDAIEIYRLGNRLFGRAQEVAKKFMEIRGLGIINVERFYGLQITKQRTEIQLMVNLLSLEKQTTVTFERLGTELKKQRLLGVDLSFYEIPISPGRKTSEIIESAVIDFKLKHSGYNSALDFIENQKAILKRK 308
               SCOP domains d1knxb1 B:1-132 HPr kinase/phoshatase HprK N-terminal domain                                                                        d1knxb2 B:133-308 HPr kinase HprK C-terminal domain                                                                                                                              SCOP domains
               CATH domains 1knxB01 B:1-133  [code=3.40.1390.20, no name defined]                                                                                1knxB02 B:134-308 P-loop containing nucleotide triphosphate hydrolases                                                                                                          CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eehhhhhhhh...eeeeehhhhh..ee.eeeeeehhhhhh........eeeeehhhhhhhhhhhhhhhhhhhhhhhhh.....eee......hhhhhhhhhhhh..eeee..hhhhhh.hhhhhhhhhhh.eeee..eeeee..eeeeee.....hhhhhhhhhhh...eeeee..eeeeee..eeeeee......eeee...eeeehhhhhhhhhh..eeeeeeeeeee...----...........eeee..eeeeeeeee.....hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1knx B   1 MKKLLVKELIEQFQDCVNLIDGHTNTSNVIRVPGLKRVVFEMLGLFSSQIGSVAILGKREFGFLSQKTLVEQQQILHNLLKLNPPAIILTKSFTDPTVLLQVNQTYQVPILKTDFFSTELSFTVETYINEQFATVAQIHGVLLEVFGVGVLLTGRSGIGKSECALDLINKNHLFVGDDAIEIYRLGNRLFGRAQEVAKKFMEIRGLGIINVERFYGLQITKQRTEIQLMVNLLSLE----VTFERLGTELKKQRLLGVDLSFYEIPISPGRKTSEIIESAVIDFKLKHSGYNSALDFIENQKAILKRK 308
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230     |   -|      250       260       270       280       290       300        
                                                                                                                                                                                                                                                                     236  241                                                                   


Chain C from PDB  Type:PROTEIN  Length:300
 aligned with HPRK_MYCPN | P75548 from UniProtKB/Swiss-Prot  Length:312

    Alignment length:311
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310 
           HPRK_MYCPN     1 MKKLLVKELIEQFQDCVNLIDGHTNTSNVIRVPGLKRVVFEMLGLFSSQIGSVAILGKREFGFLSQKTLVEQQQILHNLLKLNPPAIILTKSFTDPTVLLQVNQTYQVPILKTDFFSTELSFTVETYINEQFATVAQIHGVLLEVFGVGVLLTGRSGIGKSECALDLINKNHLFVGDDAIEIYRLGNRLFGRAQEVAKKFMEIRGLGIINVERFYGLQITKQRTEIQLMVNLLSLEKQTTVTFERLGTELKKQRLLGVDLSFYEIPISPGRKTSEIIESAVIDFKLKHSGYNSALDFIENQKAILKRKKDE 311
               SCOP domains d1knxc1 C:1-132 HPr kinase/phoshatase HprK N-terminal domain                                                                        d1knxc2 C:133-311 HPr kinase HprK C-terminal domain                                                                                                                                 SCOP domains
               CATH domains 1knxC01 C:1-133  [code=3.40.1390.20, no name defined]                                                                                1knxC02 C:134-308 P-loop containing nucleotide triphosphate hydrolases                                                                                                         --- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhh...eeeeehhhhh.....eeeeeehhhhhh........eeeeehhhhhhhhhh.hhhhhhhhhhhhhh.....eee......hhhhhhhhh.....eeee..hhhhhhhhhhhhhhhhhh.eeee..eeeee..eeeeeee.hhhhhhhhhhhhhh...eeeee..eeeeee..eeeeee......eeee...eeeehhhhhhhhhh..eeeeeeeeeee.-----------......eeee..eeeeeeeee.....hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1knx C   1 MKKLLVKELIEQFQDCVNLIDGHTNTSNVIRVPGLKRVVFEMLGLFSSQIGSVAILGKREFGFLSQKTLVEQQQILHNLLKLNPPAIILTKSFTDPTVLLQVNQTYQVPILKTDFFSTELSFTVETYINEQFATVAQIHGVLLEVFGVGVLLTGRSGIGKSECALDLINKNHLFVGDDAIEIYRLGNRLFGRAQEVAKKFMEIRGLGIINVERFYGLQITKQRTEIQLMVNLLS-----------LGTELKKQRLLGVDLSFYEIPISPGRKTSEIIESAVIDFKLKHSGYNSALDFIENQKAILKRKKDE 311
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230   |     -     | 250       260       270       280       290       300       310 
                                                                                                                                                                                                                                                                   234         246                                                                 


Chain D from PDB  Type:PROTEIN  Length:304
 aligned with HPRK_MYCPN | P75548 from UniProtKB/Swiss-Prot  Length:312

    Alignment length:307
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       
           HPRK_MYCPN     1 MKKLLVKELIEQFQDCVNLIDGHTNTSNVIRVPGLKRVVFEMLGLFSSQIGSVAILGKREFGFLSQKTLVEQQQILHNLLKLNPPAIILTKSFTDPTVLLQVNQTYQVPILKTDFFSTELSFTVETYINEQFATVAQIHGVLLEVFGVGVLLTGRSGIGKSECALDLINKNHLFVGDDAIEIYRLGNRLFGRAQEVAKKFMEIRGLGIINVERFYGLQITKQRTEIQLMVNLLSLEKQTTVTFERLGTELKKQRLLGVDLSFYEIPISPGRKTSEIIESAVIDFKLKHSGYNSALDFIENQKAILKR 307
               SCOP domains d1knxd1 D:1-132 HPr kinase/phoshatase HprK N-terminal domain                                                                        d1knxd2 D:133-307 HPr kinase HprK C-terminal domain                                                                                                                             SCOP domains
               CATH domains 1knxD01 D:1-133  [code=3.40.1390.20, no name defined]                                                                                1knxD02 D:134-307 P-loop containing nucleotide triphosphate hydrolases                                                                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eehhhhhhhh...eee..hhhhh..ee.eeeeee..hhhhh.......eeeeehhhhhhhhhh.hhhhhhhhhhhhhh.....eee......hhhhhhhhh.....eeee..hhhhhhhhhhhhhhhhhh.eeee..eeeee..eeeeee...hhhhhhhhhhhhh...eeeee..eeeeee..eeeeee......eeee...eeeehhhhhhhhhh..eeeeeeeeeee...---............eeee..eeeeeeeee.....hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1knx D   1 MKKLLVKELIEQFQDCVNLIDGHTNTSNVIRVPGLKRVVFEMLGLFSSQIGSVAILGKREFGFLSQKTLVEQQQILHNLLKLNPPAIILTKSFTDPTVLLQVNQTYQVPILKTDFFSTELSFTVETYINEQFATVAQIHGVLLEVFGVGVLLTGRSGIGKSECALDLINKNHLFVGDDAIEIYRLGNRLFGRAQEVAKKFMEIRGLGIINVERFYGLQITKQRTEIQLMVNLLSLE---TVTFERLGTELKKQRLLGVDLSFYEIPISPGRKTSEIIESAVIDFKLKHSGYNSALDFIENQKAILKR 307
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230     | 240       250       260       270       280       290       300       
                                                                                                                                                                                                                                                                     236 240                                                                   


Chain E from PDB  Type:PROTEIN  Length:310
 aligned with HPRK_MYCPN | P75548 from UniProtKB/Swiss-Prot  Length:312

    Alignment length:311
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310 
           HPRK_MYCPN     1 MKKLLVKELIEQFQDCVNLIDGHTNTSNVIRVPGLKRVVFEMLGLFSSQIGSVAILGKREFGFLSQKTLVEQQQILHNLLKLNPPAIILTKSFTDPTVLLQVNQTYQVPILKTDFFSTELSFTVETYINEQFATVAQIHGVLLEVFGVGVLLTGRSGIGKSECALDLINKNHLFVGDDAIEIYRLGNRLFGRAQEVAKKFMEIRGLGIINVERFYGLQITKQRTEIQLMVNLLSLEKQTTVTFERLGTELKKQRLLGVDLSFYEIPISPGRKTSEIIESAVIDFKLKHSGYNSALDFIENQKAILKRKKDE 311
               SCOP domains d1knxe1 E:1-132 HPr kinase/phoshatase HprK N-terminal domain                                                                        d1knxe2 E:133-311 HPr kinase HprK C-terminal domain                                                                                                                                 SCOP domains
               CATH domains 1knxE01 E:1-133  [code=3.40.1390.20, no name defined]                                                                                1knxE02 E:134-309 P-loop containing nucleotide triphosphate hydrolases                                                                                                          -- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhh....eeeehhhhh...........hhhhhh..........eeehhhhhhhhhh.hhhhhhhhhhhhhhh....eee......hhhhhhhhhhhh..eee...hhhhhhhhhhhhhhhhh..eeeeeeeeeee..eeeeee..hhhhhhhhhhhhhh...eeeeeeeeeeeee..eeeeee......eeee...eeeehhhhhhhhhh...eeeeeeeeee.....-...........eeeee..eeeeeeeee.....hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1knx E   1 MKKLLVKELIEQFQDCVNLIDGHTNTSNVIRVPGLKRVVFEMLGLFSSQIGSVAILGKREFGFLSQKTLVEQQQILHNLLKLNPPAIILTKSFTDPTVLLQVNQTYQVPILKTDFFSTELSFTVETYINEQFATVAQIHGVLLEVFGVGVLLTGRSGIGKSECALDLINKNHLFVGDDAIEIYRLGNRLFGRAQEVAKKFMEIRGLGIINVERFYGLQITKQRTEIQLMVNLLSLEKQ-TVTFERLGTELKKQRLLGVDLSFYEIPISPGRKTSEIIESAVIDFKLKHSGYNSALDFIENQKAILKRKKDE 311
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310 
                                                                                                                                                                                                                                                                       238 |                                                                       
                                                                                                                                                                                                                                                                         240                                                                       


Chain F from PDB  Type:PROTEIN  Length:306
 aligned with HPRK_MYCPN | P75548 from UniProtKB/Swiss-Prot  Length:312

    Alignment length:307
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       
           HPRK_MYCPN     1 MKKLLVKELIEQFQDCVNLIDGHTNTSNVIRVPGLKRVVFEMLGLFSSQIGSVAILGKREFGFLSQKTLVEQQQILHNLLKLNPPAIILTKSFTDPTVLLQVNQTYQVPILKTDFFSTELSFTVETYINEQFATVAQIHGVLLEVFGVGVLLTGRSGIGKSECALDLINKNHLFVGDDAIEIYRLGNRLFGRAQEVAKKFMEIRGLGIINVERFYGLQITKQRTEIQLMVNLLSLEKQTTVTFERLGTELKKQRLLGVDLSFYEIPISPGRKTSEIIESAVIDFKLKHSGYNSALDFIENQKAILKR 307
               SCOP domains d1knxf1 F:1-132 HPr kinase/phoshatase HprK N-terminal domain                                                                        d1knxf2 F:133-307 HPr kinase HprK C-terminal domain                                                                                                                             SCOP domains
               CATH domains 1knxF01 F:1-133  [code=3.40.1390.20, no name defined]                                                                                1knxF02 F:134-307 P-loop containing nucleotide triphosphate hydrolases                                                                                                         CATH domains
           Pfam domains (1) -Hpr_kinase_N-1knxF01 F:2-129                                                                                                    Hpr_kinase_C-1knxF07 F:130-301                                                                                                                                              ------ Pfam domains (1)
           Pfam domains (2) -Hpr_kinase_N-1knxF02 F:2-129                                                                                                    Hpr_kinase_C-1knxF08 F:130-301                                                                                                                                              ------ Pfam domains (2)
           Pfam domains (3) -Hpr_kinase_N-1knxF03 F:2-129                                                                                                    Hpr_kinase_C-1knxF09 F:130-301                                                                                                                                              ------ Pfam domains (3)
           Pfam domains (4) -Hpr_kinase_N-1knxF04 F:2-129                                                                                                    Hpr_kinase_C-1knxF10 F:130-301                                                                                                                                              ------ Pfam domains (4)
           Pfam domains (5) -Hpr_kinase_N-1knxF05 F:2-129                                                                                                    Hpr_kinase_C-1knxF11 F:130-301                                                                                                                                              ------ Pfam domains (5)
           Pfam domains (6) -Hpr_kinase_N-1knxF06 F:2-129                                                                                                    Hpr_kinase_C-1knxF12 F:130-301                                                                                                                                              ------ Pfam domains (6)
         Sec.struct. author ...eehhhhhhhh....eeeehhhhh..ee....ee.hhhhhh.........eeeehhhhhhhhhh.hhhhhhhhhhhhhh.....eee......hhhhhhhhhhhh..eee...hhhhhhhhhhhhhhhhh..eeee..eeeee..eeeeeee..hhhhhhhhhhhhh...eeeee..eeeeee..eeeeee......eeee...eeeehhhhhhhhhh..eeeeeeeeeee....-.............eeee..eeeeeeeee.....hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1knx F   1 MKKLLVKELIEQFQDCVNLIDGHTNTSNVIRVPGLKRVVFEMLGLFSSQIGSVAILGKREFGFLSQKTLVEQQQILHNLLKLNPPAIILTKSFTDPTVLLQVNQTYQVPILKTDFFSTELSFTVETYINEQFATVAQIHGVLLEVFGVGVLLTGRSGIGKSECALDLINKNHLFVGDDAIEIYRLGNRLFGRAQEVAKKFMEIRGLGIINVERFYGLQITKQRTEIQLMVNLLSLEK-TTVTFERLGTELKKQRLLGVDLSFYEIPISPGRKTSEIIESAVIDFKLKHSGYNSALDFIENQKAILKR 307
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230      |240       250       260       270       280       290       300       
                                                                                                                                                                                                                                                                      237 |                                                                    
                                                                                                                                                                                                                                                                        239
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 12)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (2, 12)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (2, 12)

Asymmetric/Biological Unit
(-)
Clan: MurF-HprK_N (2)
(-)
Clan: PEP-carboxyk (36)

(-) Gene Ontology  (19, 19)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C,D,E,F   (HPRK_MYCPN | P75548)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0000287    magnesium ion binding    Interacting selectively and non-covalently with magnesium (Mg) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0000155    phosphorelay sensor kinase activity    Catalysis of the phosphorylation of a histidine residue in response to detection of an extracellular signal such as a chemical ligand or change in environment, to initiate a change in cell state or activity. The two-component sensor is a histidine kinase that autophosphorylates a histidine residue in its active site. The phosphate is then transferred to an aspartate residue in a downstream response regulator, to trigger a response.
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0004674    protein serine/threonine kinase activity    Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
    GO:0004712    protein serine/threonine/tyrosine kinase activity    Catalysis of the reactions: ATP + a protein serine = ADP + protein serine phosphate; ATP + a protein threonine = ADP + protein threonine phosphate; and ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0000160    phosphorelay signal transduction system    A conserved series of molecular signals found in prokaryotes and eukaryotes; involves autophosphorylation of a histidine kinase and the transfer of the phosphate group to an aspartate that then acts as a phospho-donor to response regulator proteins.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0006109    regulation of carbohydrate metabolic process    Any process that modulates the frequency, rate or extent of the chemical reactions and pathways involving carbohydrates.
    GO:0023014    signal transduction by protein phosphorylation    A process in which the transfer of one or more phosphate groups to a substrate transmits a signal to the phosphorylated substrate.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1knx)
 
  Sites
(no "Sites" information available for 1knx)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1knx)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1knx
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HPRK_MYCPN | P75548
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.1.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
  3.1.3.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  HPRK_MYCPN | P75548
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1KNX)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1KNX)