Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF REOVIRUS ATTACHMENT PROTEIN SIGMA1 TRIMER
 
Authors :  J. D. Chappell, A. E. Prota, T. S. Dermody, T. Stehle
Date :  07 Dec 01  (Deposition) - 21 Dec 01  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Reovirus, Sigma1, Fiber, Beta-Spiral, Beta-Barrel, Trimer, Receptor-Binding, Viral Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. D. Chappell, A. E. Prota, T. S. Dermody, T. Stehle
Crystal Structure Of Reovirus Attachment Protein Sigma1 Reveals Evolutionary Relationship To Adenovirus Fiber.
Embo J. V. 21 1 2002
PubMed-ID: 11782420  |  Reference-DOI: 10.1093/EMBOJ/21.1.1
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - SIGMA 1 PROTEIN
    Chains: A, B, C
    Engineered: YES
    Expression System: SPODOPTERA FRUGIPERDA
    Expression System Cell Line: SF21
    Expression System Common: FALL ARMYWORM
    Expression System Taxid: 7108
    Expression System Vector Type: BACULOVIRUS
    Organism Scientific: MAMMALIAN ORTHOREOVIRUS 3
    Organism Taxid: 10886
    Strain: TYPE 3 STRAIN DEARING
    Synonym: HEMAGGLUTININ, CELL ATTACHMENT PROTEIN, MINOR OUTER CAPSID PROTEIN

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit : ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1KKE)

(-) Sites  (0, 0)

(no "Site" information available for 1KKE)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1KKE)

(-) Cis Peptide Bonds  (9, 9)

Asymmetric/Biological Unit
No.Residues
1Thr A:259 -Pro A:260
2Tyr A:298 -Pro A:299
3Pro A:376 -Pro A:377
4Thr B:259 -Pro B:260
5Tyr B:298 -Pro B:299
6Pro B:376 -Pro B:377
7Thr C:259 -Pro C:260
8Tyr C:298 -Pro C:299
9Pro C:376 -Pro C:377

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1KKE)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1KKE)

(-) Exons   (0, 0)

(no "Exon" information available for 1KKE)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:206
 aligned with SIGM1_REOVD | P03528 from UniProtKB/Swiss-Prot  Length:455

    Alignment length:206
                                   259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449      
          SIGM1_REOVD   250 EQSYVASAVTPLRLNSSTKVLDMLIDSSTLEINSSGQLTVRSTSPNLRYPIADVSGGIGMSPNYRFRQSMWIGIVSYSGSGLNWRVQVNSDIFIVDDYIHICLPAFDGFSIADGGDLSLNFVTGLLPPLLTGDTEPAFHNDVVTYGAQTVAIGLSSGGAPQYMSKNLWVEQWQDGVLRLRVEGGGSITHSNSKWPAMTVSYPRSFT 455
               SCOP domains d1kkea1 A:250-312 Reovirus attachment protein sigma 1          d1kkea2 A:313-455 Reovirus attachment protein sigma 1 head domain                                                                               SCOP domains
               CATH domains 1kkeA01 A:250-292                          ----------------------1kkeA02 A:315-455 Virus attachment protein , globular domain                                                                                  CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........eee......eee......eee.....eee..........eeee..eeeehhhhhheeeeeeeeeeeee..eeeeeeeeeeeeee..eeeeee..eeee....eeeeeee.........hhhhhh.........eeeeeeeeeee.....eeeeeeeeeeeee..eeeeeee........eeee..eeeeee.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1kke A 250 EQSYVASAVTPLRLNSSTKVLDMLIDSSTLEINSSGQLTVRSTSPNLRYPIADVSGGIGMSPNYRFRQSMWIGIVSYSGSGLNWRVQVNSDIFIVDDYIHICLPAFDGFSIADGGDLSLNFVTGLLPPLLTGDTEPAFHNDVVTYGAQTVAIGLSSGGAPQYMSKNLWVEQWQDGVLRLRVEGGGSITHSNSKWPAMTVSYPRSFT 455
                                   259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449      


Chain B from PDB  Type:PROTEIN  Length:205
 aligned with SIGM1_REOVD | P03528 from UniProtKB/Swiss-Prot  Length:455

    Alignment length:205
                                   260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450     
          SIGM1_REOVD   251 QSYVASAVTPLRLNSSTKVLDMLIDSSTLEINSSGQLTVRSTSPNLRYPIADVSGGIGMSPNYRFRQSMWIGIVSYSGSGLNWRVQVNSDIFIVDDYIHICLPAFDGFSIADGGDLSLNFVTGLLPPLLTGDTEPAFHNDVVTYGAQTVAIGLSSGGAPQYMSKNLWVEQWQDGVLRLRVEGGGSITHSNSKWPAMTVSYPRSFT 455
               SCOP domains d1kkeb1 B:251-312 Reovirus attachment protein sigma 1         d1kkeb2 B:313-455 Reovirus attachment protein sigma 1 head domain                                                                               SCOP domains
               CATH domains 1kkeB01 B:251-292                         ----------------------1kkeB02 B:315-455 Virus attachment protein , globular domain                                                                                  CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........eee.....eeee......eee.....eee..........eeee..eeeehhhhhheeeeeeeeeeeee..eeeeeeeeeeeeee..eeeeee..eeee....eeeeeee.........hhhhhh.........eeeeeeeeeee.....eeeeeeeeeeeee.......ee........eeee..eeeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1kke B 251 QSYVASAVTPLRLNSSTKVLDMLIDSSTLEINSSGQLTVRSTSPNLRYPIADVSGGIGMSPNYRFRQSMWIGIVSYSGSGLNWRVQVNSDIFIVDDYIHICLPAFDGFSIADGGDLSLNFVTGLLPPLLTGDTEPAFHNDVVTYGAQTVAIGLSSGGAPQYMSKNLWVEQWQDGVLRLRVEGGGSITHSNSKWPAMTVSYPRSFT 455
                                   260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450     


Chain C from PDB  Type:PROTEIN  Length:206
 aligned with SIGM1_REOVD | P03528 from UniProtKB/Swiss-Prot  Length:455

    Alignment length:206
                                   259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449      
          SIGM1_REOVD   250 EQSYVASAVTPLRLNSSTKVLDMLIDSSTLEINSSGQLTVRSTSPNLRYPIADVSGGIGMSPNYRFRQSMWIGIVSYSGSGLNWRVQVNSDIFIVDDYIHICLPAFDGFSIADGGDLSLNFVTGLLPPLLTGDTEPAFHNDVVTYGAQTVAIGLSSGGAPQYMSKNLWVEQWQDGVLRLRVEGGGSITHSNSKWPAMTVSYPRSFT 455
               SCOP domains d1kkec1 C:250-312 Reovirus attachment protein sigma 1          d1kkec2 C:313-455 Reovirus attachment protein sigma 1 head domain                                                                               SCOP domains
               CATH domains -1kkeC01 C:251-292                         ----------------------1kkeC02 C:315-455 Virus attachment protein , globular domain                                                                                  CATH domains
           Pfam domains (1) Reo_sigma1-1kkeC01 C:250-454                                                                                                                                                                                 - Pfam domains (1)
           Pfam domains (2) Reo_sigma1-1kkeC02 C:250-454                                                                                                                                                                                 - Pfam domains (2)
           Pfam domains (3) Reo_sigma1-1kkeC03 C:250-454                                                                                                                                                                                 - Pfam domains (3)
         Sec.struct. author ......ee...eee......eee......eee.....eee..........eeee..eeeehhhhhheeeeeeeeeeeee..eeeeeeeeeeeeee..eeeeee..eeee....eeeeeee.........hhhhhh.........eeeeeeeeeee.....eeeeeeeeeeeee..eeeeeee........eeee..eeeeee.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1kke C 250 EQSYVASAVTPLRLNSSTKVLDMLIDSSTLEINSSGQLTVRSTSPNLRYPIADVSGGIGMSPNYRFRQSMWIGIVSYSGSGLNWRVQVNSDIFIVDDYIHICLPAFDGFSIADGGDLSLNFVTGLLPPLLTGDTEPAFHNDVVTYGAQTVAIGLSSGGAPQYMSKNLWVEQWQDGVLRLRVEGGGSITHSNSKWPAMTVSYPRSFT 455
                                   259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 6)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (2, 6)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 3)

Asymmetric/Biological Unit
(-)
Clan: Reo_sigma (16)

(-) Gene Ontology  (8, 8)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C   (SIGM1_REOVD | P03528)
biological process
    GO:0007155    cell adhesion    The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
    GO:0046718    viral entry into host cell    The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
    GO:0019058    viral life cycle    A set of processes which all viruses follow to ensure survival; includes attachment and entry of the virus particle, decoding of genome information, translation of viral mRNA by host ribosomes, genome replication, and assembly and release of viral particles containing the genome.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
    GO:0019062    virion attachment to host cell    The process by which a virion protein binds to molecules on the host cellular surface or host cell surface projection.
cellular component
    GO:0019028    viral capsid    The protein coat that surrounds the infective nucleic acid in some virus particles. It comprises numerous regularly arranged subunits, or capsomeres.
    GO:0039624    viral outer capsid    The outer layer of a double or triple concentric icosahedral capsid. Outer capsids are part of reoviridae and cystoviridae virions.
    GO:0019012    virion    The complete fully infectious extracellular virus particle.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1kke)
 
  Sites
(no "Sites" information available for 1kke)
 
  Cis Peptide Bonds
    Pro A:376 - Pro A:377   [ RasMol ]  
    Pro B:376 - Pro B:377   [ RasMol ]  
    Pro C:376 - Pro C:377   [ RasMol ]  
    Thr A:259 - Pro A:260   [ RasMol ]  
    Thr B:259 - Pro B:260   [ RasMol ]  
    Thr C:259 - Pro C:260   [ RasMol ]  
    Tyr A:298 - Pro A:299   [ RasMol ]  
    Tyr B:298 - Pro B:299   [ RasMol ]  
    Tyr C:298 - Pro C:299   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1kke
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SIGM1_REOVD | P03528
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  SIGM1_REOVD | P03528
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SIGM1_REOVD | P03528: 2oj5 2oj6 3eoy 3s6x 3s6y 3s6z

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1KKE)