1KAW - JenaLib

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:96
 aligned with SSB_ECO57 | P0AGE2 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:110
                                    13        23        33        43        53        63        73        83        93       103       113
            SSB_ECO57     4 RGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 113
               SCOP domains d1kawa_ A: ssDNA-bind    ing protein                                                                           SCOP domains
               CATH domains 1kawA00 A:3-112 Nucle    ic acid-bind          ing proteins                                                    CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee..........----..eeeeeee...----------...eeeeeee.hhhhhhhhhh.....eeeeeeeeeeee.........eeeeeee....eeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --SSB  PDB: A:5-110 UniProt: 6-111                                                                          -- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------- Transcript
                 1kaw A   3 RGVNKVILVGNLGQDPEVRYM----AVANITLATSES----------EQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 112
                                    12        22|    |  32      |  -       |52        62        72        82        92       102       112
                                               23   28         39         50

Chain A from PDB  Type:PROTEIN  Length:96
 aligned with SSB_ECOL6 | P0AGE1 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:110
                                    13        23        33        43        53        63        73        83        93       103       113
            SSB_ECOL6     4 RGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 113
               SCOP domains d1kawa_ A: ssDNA-bind    ing protein                                                                           SCOP domains
               CATH domains 1kawA00 A:3-112 Nucle    ic acid-bind          ing proteins                                                    CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee..........----..eeeeeee...----------...eeeeeee.hhhhhhhhhh.....eeeeeeeeeeee.........eeeeeee....eeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --SSB  PDB: A:5-110 UniProt: 6-111                                                                          -- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------- Transcript
                 1kaw A   3 RGVNKVILVGNLGQDPEVRYM----AVANITLATSES----------EQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 112
                                    12        22|    |  32      |  -       |52        62        72        82        92       102       112
                                               23   28         39         50

Chain A from PDB  Type:PROTEIN  Length:96
 aligned with SSB_ECOLI | P0AGE0 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:110
                                    13        23        33        43        53        63        73        83        93       103       113
            SSB_ECOLI     4 RGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 113
               SCOP domains d1kawa_ A: ssDNA-bind    ing protein                                                                           SCOP domains
               CATH domains 1kawA00 A:3-112 Nucle    ic acid-bind          ing proteins                                                    CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee..........----..eeeeeee...----------...eeeeeee.hhhhhhhhhh.....eeeeeeeeeeee.........eeeeeee....eeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --SSB  PDB: A:5-110 UniProt: 6-111                                                                          -- PROSITE (3)
                 Transcript -------------------------------------------------------------------------------------------------------------- Transcript
                 1kaw A   3 RGVNKVILVGNLGQDPEVRYM----AVANITLATSES----------EQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 112
                                    12        22|    |  32      |  -       |52        62        72        82        92       102       112
                                               23   28         39         50

Chain A from PDB  Type:PROTEIN  Length:96
 aligned with SSB_SHIFL | P0AGE3 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:110
                                    13        23        33        43        53        63        73        83        93       103       113
            SSB_SHIFL     4 RGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 113
               SCOP domains d1kawa_ A: ssDNA-bind    ing protein                                                                           SCOP domains
               CATH domains 1kawA00 A:3-112 Nucle    ic acid-bind          ing proteins                                                    CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee..........----..eeeeeee...----------...eeeeeee.hhhhhhhhhh.....eeeeeeeeeeee.........eeeeeee....eeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --SSB  PDB: A:5-110 UniProt: 6-111                                                                          -- PROSITE (4)
                 Transcript -------------------------------------------------------------------------------------------------------------- Transcript
                 1kaw A   3 RGVNKVILVGNLGQDPEVRYM----AVANITLATSES----------EQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 112
                                    12        22|    |  32      |  -       |52        62        72        82        92       102       112
                                               23   28         39         50

Chain B from PDB  Type:PROTEIN  Length:96
 aligned with SSB_ECO57 | P0AGE2 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:110
                                    13        23        33        43        53        63        73        83        93       103       113
            SSB_ECO57     4 RGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 113
               SCOP domains d1kawb_ B: ssDNA-bind    ing protein                                                                           SCOP domains
               CATH domains 1kawB00 B:3-112 Nucle    ic acid-bind          ing proteins                                                    CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee..........----..eeeeeee...----------...eeeeeee.hhhhhhhhhh.....eeeeeeeeeeee.........eeeeeee....eeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --SSB  PDB: B:5-110 UniProt: 6-111                                                                          -- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------- Transcript
                 1kaw B   3 RGVNKVILVGNLGQDPEVRYM----AVANITLATSES----------EQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 112
                                    12        22|    |  32      |  -       |52        62        72        82        92       102       112
                                               23   28         39         50

Chain B from PDB  Type:PROTEIN  Length:96
 aligned with SSB_ECOL6 | P0AGE1 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:110
                                    13        23        33        43        53        63        73        83        93       103       113
            SSB_ECOL6     4 RGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 113
               SCOP domains d1kawb_ B: ssDNA-bind    ing protein                                                                           SCOP domains
               CATH domains 1kawB00 B:3-112 Nucle    ic acid-bind          ing proteins                                                    CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee..........----..eeeeeee...----------...eeeeeee.hhhhhhhhhh.....eeeeeeeeeeee.........eeeeeee....eeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --SSB  PDB: B:5-110 UniProt: 6-111                                                                          -- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------- Transcript
                 1kaw B   3 RGVNKVILVGNLGQDPEVRYM----AVANITLATSES----------EQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 112
                                    12        22|    |  32      |  -       |52        62        72        82        92       102       112
                                               23   28         39         50

Chain B from PDB  Type:PROTEIN  Length:96
 aligned with SSB_ECOLI | P0AGE0 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:110
                                    13        23        33        43        53        63        73        83        93       103       113
            SSB_ECOLI     4 RGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 113
               SCOP domains d1kawb_ B: ssDNA-bind    ing protein                                                                           SCOP domains
               CATH domains 1kawB00 B:3-112 Nucle    ic acid-bind          ing proteins                                                    CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee..........----..eeeeeee...----------...eeeeeee.hhhhhhhhhh.....eeeeeeeeeeee.........eeeeeee....eeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --SSB  PDB: B:5-110 UniProt: 6-111                                                                          -- PROSITE (3)
                 Transcript -------------------------------------------------------------------------------------------------------------- Transcript
                 1kaw B   3 RGVNKVILVGNLGQDPEVRYM----AVANITLATSES----------EQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 112
                                    12        22|    |  32      |  -       |52        62        72        82        92       102       112
                                               23   28         39         50

Chain B from PDB  Type:PROTEIN  Length:96
 aligned with SSB_SHIFL | P0AGE3 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:110
                                    13        23        33        43        53        63        73        83        93       103       113
            SSB_SHIFL     4 RGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 113
               SCOP domains d1kawb_ B: ssDNA-bind    ing protein                                                                           SCOP domains
               CATH domains 1kawB00 B:3-112 Nucle    ic acid-bind          ing proteins                                                    CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee..........----..eeeeeee...----------...eeeeeee.hhhhhhhhhh.....eeeeeeeeeeee.........eeeeeee....eeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --SSB  PDB: B:5-110 UniProt: 6-111                                                                          -- PROSITE (4)
                 Transcript -------------------------------------------------------------------------------------------------------------- Transcript
                 1kaw B   3 RGVNKVILVGNLGQDPEVRYM----AVANITLATSES----------EQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 112
                                    12        22|    |  32      |  -       |52        62        72        82        92       102       112
                                               23   28         39         50

Chain C from PDB  Type:PROTEIN  Length:96
 aligned with SSB_ECO57 | P0AGE2 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:110
                                    13        23        33        43        53        63        73        83        93       103       113
            SSB_ECO57     4 RGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 113
               SCOP domains d1kawc_ C: ssDNA-bind    ing protein                                                                           SCOP domains
               CATH domains 1kawC00 C:3-112 Nucle    ic acid-bind          ing proteins                                                    CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee..........----..eeeeeee...----------...eeeeeee.hhhhhhhhhh.....eeeeeeeeeeee.........eeeeeee....eeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --SSB  PDB: C:5-110 UniProt: 6-111                                                                          -- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------- Transcript
                 1kaw C   3 RGVNKVILVGNLGQDPEVRYM----AVANITLATSES----------EQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 112
                                    12        22|    |  32      |  -       |52        62        72        82        92       102       112
                                               23   28         39         50

Chain C from PDB  Type:PROTEIN  Length:96
 aligned with SSB_ECOL6 | P0AGE1 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:110
                                    13        23        33        43        53        63        73        83        93       103       113
            SSB_ECOL6     4 RGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 113
               SCOP domains d1kawc_ C: ssDNA-bind    ing protein                                                                           SCOP domains
               CATH domains 1kawC00 C:3-112 Nucle    ic acid-bind          ing proteins                                                    CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee..........----..eeeeeee...----------...eeeeeee.hhhhhhhhhh.....eeeeeeeeeeee.........eeeeeee....eeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --SSB  PDB: C:5-110 UniProt: 6-111                                                                          -- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------- Transcript
                 1kaw C   3 RGVNKVILVGNLGQDPEVRYM----AVANITLATSES----------EQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 112
                                    12        22|    |  32      |  -       |52        62        72        82        92       102       112
                                               23   28         39         50

Chain C from PDB  Type:PROTEIN  Length:96
 aligned with SSB_ECOLI | P0AGE0 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:110
                                    13        23        33        43        53        63        73        83        93       103       113
            SSB_ECOLI     4 RGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 113
               SCOP domains d1kawc_ C: ssDNA-bind    ing protein                                                                           SCOP domains
               CATH domains 1kawC00 C:3-112 Nucle    ic acid-bind          ing proteins                                                    CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee..........----..eeeeeee...----------...eeeeeee.hhhhhhhhhh.....eeeeeeeeeeee.........eeeeeee....eeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --SSB  PDB: C:5-110 UniProt: 6-111                                                                          -- PROSITE (3)
                 Transcript -------------------------------------------------------------------------------------------------------------- Transcript
                 1kaw C   3 RGVNKVILVGNLGQDPEVRYM----AVANITLATSES----------EQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 112
                                    12        22|    |  32      |  -       |52        62        72        82        92       102       112
                                               23   28         39         50

Chain C from PDB  Type:PROTEIN  Length:96
 aligned with SSB_SHIFL | P0AGE3 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:110
                                    13        23        33        43        53        63        73        83        93       103       113
            SSB_SHIFL     4 RGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 113
               SCOP domains d1kawc_ C: ssDNA-bind    ing protein                                                                           SCOP domains
               CATH domains 1kawC00 C:3-112 Nucle    ic acid-bind          ing proteins                                                    CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee..........----..eeeeeee...----------...eeeeeee.hhhhhhhhhh.....eeeeeeeeeeee.........eeeeeee....eeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --SSB  PDB: C:5-110 UniProt: 6-111                                                                          -- PROSITE (4)
                 Transcript -------------------------------------------------------------------------------------------------------------- Transcript
                 1kaw C   3 RGVNKVILVGNLGQDPEVRYM----AVANITLATSES----------EQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 112
                                    12        22|    |  32      |  -       |52        62        72        82        92       102       112
                                               23   28         39         50

Chain D from PDB  Type:PROTEIN  Length:96
 aligned with SSB_ECO57 | P0AGE2 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:110
                                    13        23        33        43        53        63        73        83        93       103       113
            SSB_ECO57     4 RGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 113
               SCOP domains d1kawd_ D: ssDNA-bind    ing protein                                                                           SCOP domains
               CATH domains 1kawD00 D:3-112 Nucle    ic acid-bind          ing proteins                                                    CATH domains
           Pfam domains (1) --SSB-1kawD01 D:5-112                                                                                          Pfam domains (1)
           Pfam domains (2) --SSB-1kawD02 D:5-112                                                                                          Pfam domains (2)
           Pfam domains (3) --SSB-1kawD03 D:5-112                                                                                          Pfam domains (3)
           Pfam domains (4) --SSB-1kawD04 D:5-112                                                                                          Pfam domains (4)
         Sec.struct. author ..eeeeeeeee..........----..eeeeeee...----------...eeeeeee.hhhhhhhhhh.....eeeeeeeeeeee.........eeeeeee....eeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --SSB  PDB: D:5-110 UniProt: 6-111                                                                          -- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------- Transcript
                 1kaw D   3 RGVNKVILVGNLGQDPEVRYM----AVANITLATSES----------EQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 112
                                    12        22|    |  32      |  -       |52        62        72        82        92       102       112
                                               23   28         39         50

Chain D from PDB  Type:PROTEIN  Length:96
 aligned with SSB_ECOL6 | P0AGE1 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:110
                                    13        23        33        43        53        63        73        83        93       103       113
            SSB_ECOL6     4 RGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 113
               SCOP domains d1kawd_ D: ssDNA-bind    ing protein                                                                           SCOP domains
               CATH domains 1kawD00 D:3-112 Nucle    ic acid-bind          ing proteins                                                    CATH domains
           Pfam domains (1) --SSB-1kawD01 D:5-112                                                                                          Pfam domains (1)
           Pfam domains (2) --SSB-1kawD02 D:5-112                                                                                          Pfam domains (2)
           Pfam domains (3) --SSB-1kawD03 D:5-112                                                                                          Pfam domains (3)
           Pfam domains (4) --SSB-1kawD04 D:5-112                                                                                          Pfam domains (4)
         Sec.struct. author ..eeeeeeeee..........----..eeeeeee...----------...eeeeeee.hhhhhhhhhh.....eeeeeeeeeeee.........eeeeeee....eeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --SSB  PDB: D:5-110 UniProt: 6-111                                                                          -- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------- Transcript
                 1kaw D   3 RGVNKVILVGNLGQDPEVRYM----AVANITLATSES----------EQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 112
                                    12        22|    |  32      |  -       |52        62        72        82        92       102       112
                                               23   28         39         50

Chain D from PDB  Type:PROTEIN  Length:96
 aligned with SSB_ECOLI | P0AGE0 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:110
                                    13        23        33        43        53        63        73        83        93       103       113
            SSB_ECOLI     4 RGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 113
               SCOP domains d1kawd_ D: ssDNA-bind    ing protein                                                                           SCOP domains
               CATH domains 1kawD00 D:3-112 Nucle    ic acid-bind          ing proteins                                                    CATH domains
           Pfam domains (1) --SSB-1kawD01 D:5-112                                                                                          Pfam domains (1)
           Pfam domains (2) --SSB-1kawD02 D:5-112                                                                                          Pfam domains (2)
           Pfam domains (3) --SSB-1kawD03 D:5-112                                                                                          Pfam domains (3)
           Pfam domains (4) --SSB-1kawD04 D:5-112                                                                                          Pfam domains (4)
         Sec.struct. author ..eeeeeeeee..........----..eeeeeee...----------...eeeeeee.hhhhhhhhhh.....eeeeeeeeeeee.........eeeeeee....eeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --SSB  PDB: D:5-110 UniProt: 6-111                                                                          -- PROSITE (3)
                 Transcript -------------------------------------------------------------------------------------------------------------- Transcript
                 1kaw D   3 RGVNKVILVGNLGQDPEVRYM----AVANITLATSES----------EQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 112
                                    12        22|    |  32      |  -       |52        62        72        82        92       102       112
                                               23   28         39         50

Chain D from PDB  Type:PROTEIN  Length:96
 aligned with SSB_SHIFL | P0AGE3 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:110
                                    13        23        33        43        53        63        73        83        93       103       113
            SSB_SHIFL     4 RGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 113
               SCOP domains d1kawd_ D: ssDNA-bind    ing protein                                                                           SCOP domains
               CATH domains 1kawD00 D:3-112 Nucle    ic acid-bind          ing proteins                                                    CATH domains
           Pfam domains (1) --SSB-1kawD01 D:5-112                                                                                          Pfam domains (1)
           Pfam domains (2) --SSB-1kawD02 D:5-112                                                                                          Pfam domains (2)
           Pfam domains (3) --SSB-1kawD03 D:5-112                                                                                          Pfam domains (3)
           Pfam domains (4) --SSB-1kawD04 D:5-112                                                                                          Pfam domains (4)
         Sec.struct. author ..eeeeeeeee..........----..eeeeeee...----------...eeeeeee.hhhhhhhhhh.....eeeeeeeeeeee.........eeeeeee....eeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --SSB  PDB: D:5-110 UniProt: 6-111                                                                          -- PROSITE (4)
                 Transcript -------------------------------------------------------------------------------------------------------------- Transcript
                 1kaw D   3 RGVNKVILVGNLGQDPEVRYM----AVANITLATSES----------EQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML 112
                                    12        22|    |  32      |  -       |52        62        72        82        92       102       112
                                               23   28         39         50

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B,C,D (SSB_ECOL6 | P0AGE1)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0003697	single-stranded DNA binding	Interacting selectively and non-covalently with single-stranded DNA.
biological process
	GO:0006310	DNA recombination	Any process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents. In eukaryotes genetic recombination can occur by chromosome assortment, intrachromosomal recombination, or nonreciprocal interchromosomal recombination. Intrachromosomal recombination occurs by crossing over. In bacteria it may occur by genetic transformation, conjugation, transduction, or F-duction.
	GO:0006281	DNA repair	The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
	GO:0006260	DNA replication	The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
	GO:0006974	cellular response to DNA damage stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.

Chain A,B,C,D (SSB_SHIFL | P0AGE3)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0003697	single-stranded DNA binding	Interacting selectively and non-covalently with single-stranded DNA.
biological process
	GO:0006310	DNA recombination	Any process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents. In eukaryotes genetic recombination can occur by chromosome assortment, intrachromosomal recombination, or nonreciprocal interchromosomal recombination. Intrachromosomal recombination occurs by crossing over. In bacteria it may occur by genetic transformation, conjugation, transduction, or F-duction.
	GO:0006281	DNA repair	The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
	GO:0006260	DNA replication	The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
	GO:0006974	cellular response to DNA damage stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.

Chain A,B,C,D (SSB_ECO57 | P0AGE2)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0003697	single-stranded DNA binding	Interacting selectively and non-covalently with single-stranded DNA.
biological process
	GO:0006310	DNA recombination	Any process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents. In eukaryotes genetic recombination can occur by chromosome assortment, intrachromosomal recombination, or nonreciprocal interchromosomal recombination. Intrachromosomal recombination occurs by crossing over. In bacteria it may occur by genetic transformation, conjugation, transduction, or F-duction.
	GO:0006281	DNA repair	The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
	GO:0006260	DNA replication	The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
	GO:0006974	cellular response to DNA damage stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.

Chain A,B,C,D (SSB_ECOLI | P0AGE0)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0008047	enzyme activator activity	Binds to and increases the activity of an enzyme.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0003697	single-stranded DNA binding	Interacting selectively and non-covalently with single-stranded DNA.
biological process
	GO:0006310	DNA recombination	Any process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents. In eukaryotes genetic recombination can occur by chromosome assortment, intrachromosomal recombination, or nonreciprocal interchromosomal recombination. Intrachromosomal recombination occurs by crossing over. In bacteria it may occur by genetic transformation, conjugation, transduction, or F-duction.
	GO:0006281	DNA repair	The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
	GO:0006260	DNA replication	The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
	GO:0009432	SOS response	An error-prone process for repairing damaged microbial DNA.
	GO:0006974	cellular response to DNA damage stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
	GO:0006298	mismatch repair	A system for the correction of errors in which an incorrect base, which cannot form hydrogen bonds with the corresponding base in the parent strand, is incorporated into the daughter strand. The mismatch repair system promotes genomic fidelity by repairing base-base mismatches, insertion-deletion loops and heterologies generated during DNA replication and recombination.
	GO:0043085	positive regulation of catalytic activity	Any process that activates or increases the activity of an enzyme.
	GO:0000725	recombinational repair	A DNA repair process that involves the exchange, reciprocal or nonreciprocal, of genetic material between the broken DNA molecule and a homologous region of DNA.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 4)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (1, 4)

Gene Ontology (14, 32)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File