Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE
 
Authors :  R. Omi, I. Miyahara, K. Hirotsu, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  01 Nov 01  (Deposition) - 04 Dec 02  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym./Biol. Unit :  F,H
Keywords :  Synthase, Riken Structural Genomics/Proteomics Initiative, Rsgi, Structural Genomics, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. Omi, H. Mizuguchi, M. Goto, I. Miyahara, H. Hayashi, H. Kagamiyama, K. Hirotsu
Structure Of Imidazole Glycerol Phosphate Synthase From Thermus Thermophilus Hb8: Open-Closed Conformational Change And Ammonia Tunneling
J. Biochem. (Tokyo) V. 132 759 2002
PubMed-ID: 12417026
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - IMIDAZOLE GLYCEROL PHOSPHTATE SYNTHASE
    ChainsH
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPUC119
    Expression System StrainHB101
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneHB8
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid274
 
Molecule 2 - IMIDAZOLE GLYCEROL PHOSPHTATE SYNTHASE
    ChainsF
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPUC119
    Expression System StrainHB101
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneHB8
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid274

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit FH

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1KA9)

(-) Sites  (0, 0)

(no "Site" information available for 1KA9)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1KA9)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Val H:116 -Pro H:117

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1KA9)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1KA9)

(-) Exons   (0, 0)

(no "Exon" information available for 1KA9)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain F from PDB  Type:PROTEIN  Length:251
 aligned with HIS6_THET8 | Q7SIB9 from UniProtKB/Swiss-Prot  Length:252

    Alignment length:251
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251 
           HIS6_THET8     2 SLAKRIVPCLDVHAGRVVKGVNFVNLRDAGDPVEAARAYDEAGADELVFLDISATHEERAILLDVVARVAERVFIPLTVGGGVRSLEDARKLLLSGADKVSVNSAAVRRPELIRELADHFGAQAVVLAIDARWRGDFPEVHVAGGRVPTGLHAVEWAVKGVELGAGEILLTSMDRDGTKEGYDLRLTRMVAEAVGVPVIASGGAGRMEHFLEAFQAGAEAALAASVFHFGEIPIPKLKRYLAEKGVHVRLD 252
               SCOP domains d1ka9f_ F: Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF                                                                                                                                                                          SCOP domains
               CATH domains 1ka9F00 F:2-252 Aldolase class I                                                                                                                                                                                                                            CATH domains
               Pfam domains ----His_biosynth-1ka9F01 F:6-234                                                                                                                                                                                                         ------------------ Pfam domains
         Sec.struct. author ....eeeeeeeee..ee.............hhhhhhhhhhhhh...eeeee......hhhhhhhhhhhhhh.....eeee....hhhhhhhhhhhh..eeeehhhhhhhhhhhhhhhhhhh...eeeeeeeeee..eeeeee....eeeeeehhhhhhhhh.....eeeeee..........hhhhhhhhhhhh...eeee....hhhhhhhhhhh...eeeehhhhhh...hhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ka9 F   2 SLAKRIVPCLDVHAGRVVKGVNFVNLRDAGDPVEAARAYDEAGADELVFLDISATHEERAILLDVVARVAERVFIPLTVGGGVRSLEDARKLLLSGADKVSVNSAAVRRPELIRELADHFGAQAVVLAIDARWRGDFPEVHVAGGRVPTGLHAVEWAVKGVELGAGEILLTSMDRDGTKEGYDLRLTRMVAEAVGVPVIASGGAGRMEHFLEAFQAGAEAALAASVFHFGEIPIPKLKRYLAEKGVHVRLD 252
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251 

Chain H from PDB  Type:PROTEIN  Length:195
 aligned with HIS5_THET8 | Q7SIC0 from UniProtKB/Swiss-Prot  Length:200

    Alignment length:195
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192     
           HIS5_THET8     3 MKALLIDYGSGNLRSAAKALEAAGFSVAVAQDPKAHEEADLLVLPGQGHFGQVMRAFQESGFVERVRRHLERGLPFLGICVGMQVLYEGSEEAPGVRGLGLVPGEVRRFRAGRVPQMGWNALEFGGAFAPLTGRHFYFANSYYGPLTPYSLGKGEYEGTPFTALLAKENLLAPQFHPEKSGKAGLAFLALARRYF 197
               SCOP domains d1ka9h_ H: GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF                                                                                                               SCOP domains
               CATH domains 1ka9H00 H:3-197  [code=3.40.50.880, no name defined]                                                                                                                                                CATH domains
               Pfam domains ---GATase-1ka9H01 H:6-193                                                                                                                                                                      ---- Pfam domains
         Sec.struct. author .eeeee.....hhhhhhhhhhhh..eeeee..........eeee....hhhhhh.......hhhhhhhhhhh...eee.hhhhhh...ee..............eeee.......eeeeee.ee.hhhhhhh..eeeeee.ee........eeeee..eeeeeeee...eeee......hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ka9 H   3 MKALLIDYGSGNLRSAAKALEAAGFSVAVAQDPKAHEEADLLVLPGQGHFGQVMRAFQESGFVERVRRHLERGLPFLGICVGMQVLYEGSEEAPGVRGLGLVPGEVRRFRAGRVPQMGWNALEFGGAFAPLTGRHFYFANSYYGPLTPYSLGKGEYEGTPFTALLAKENLLAPQFHPEKSGKAGLAFLALARRYF 197
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (2, 2)

Asymmetric/Biological Unit

(-) Gene Ontology  (10, 14)

Asymmetric/Biological Unit(hide GO term definitions)
Chain F   (HIS6_THET8 | Q7SIB9)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0000107    imidazoleglycerol-phosphate synthase activity    Catalysis of the reaction: phosphoribulosylformimino-AICAR-P + L-glutamine = D-erythro-imidazole-glycerol-phosphate + aminoimidazole carboxamide ribonucleotide + L-glutamate + 2 H(+).
    GO:0016829    lyase activity    Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
biological process
    GO:0008652    cellular amino acid biosynthetic process    The chemical reactions and pathways resulting in the formation of amino acids, organic acids containing one or more amino substituents.
    GO:0000105    histidine biosynthetic process    The chemical reactions and pathways resulting in the formation of histidine, 2-amino-3-(1H-imidazol-4-yl)propanoic acid.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Chain H   (HIS5_THET8 | Q7SIC0)
molecular function
    GO:0000107    imidazoleglycerol-phosphate synthase activity    Catalysis of the reaction: phosphoribulosylformimino-AICAR-P + L-glutamine = D-erythro-imidazole-glycerol-phosphate + aminoimidazole carboxamide ribonucleotide + L-glutamate + 2 H(+).
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016763    transferase activity, transferring pentosyl groups    Catalysis of the transfer of a pentosyl group from one compound (donor) to another (acceptor).
biological process
    GO:0008652    cellular amino acid biosynthetic process    The chemical reactions and pathways resulting in the formation of amino acids, organic acids containing one or more amino substituents.
    GO:0006541    glutamine metabolic process    The chemical reactions and pathways involving glutamine, 2-amino-4-carbamoylbutanoic acid.
    GO:0000105    histidine biosynthetic process    The chemical reactions and pathways resulting in the formation of histidine, 2-amino-3-(1H-imidazol-4-yl)propanoic acid.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ka9)
 
  Sites
(no "Sites" information available for 1ka9)
 
  Cis Peptide Bonds
    Val H:116 - Pro H:117   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ka9
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HIS5_THET8 | Q7SIC0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  HIS6_THET8 | Q7SIB9
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  HIS5_THET8 | Q7SIC0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  HIS6_THET8 | Q7SIB9
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1KA9)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1KA9)