1K3E - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   TYPE III SECRETION CHAPERONE CEST

Authors :   Y. Luo, M. Bertero, E. A. Frey, R. A. Pfuetzner, M. R. Wenk, L. Creagh, S. L D. Lim, B. B. Finlay, N. C. J. Strynadka

Date :   02 Oct 01 (Deposition) - 28 Nov 01 (Release) - 25 May 16 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.80

Chains :   Asym. Unit : A,B
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: A (1x),B (1x)

Keywords :   Chaperone, Secretion, Type Iii, Intimin Receptor (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Luo, M. G. Bertero, E. A. Frey, R. A. Pfuetzner, M. R. Wenk, L. Creagh, S. L. Marcus, D. Lim, F. Sicheri, C. Kay, C. Haynes, B. B. Finlay, N. C. Strynadka
Structural And Biochemical Characterization Of The Type Iii Secretion Chaperones Cest And Sige.
Nat. Struct. Biol. V. 8 1031 2001
PubMed-ID: 11685226 | Reference-DOI: 10.1038/NSB717

Molecule 1 - CEST
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET28A
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Gene	:	CEST
	Organism Taxid	:	83334

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:	A (1x)	B (1x)

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1K3E)

(no "Site" information available for 1K3E)

(no "SS Bond" information available for 1K3E)

(no "Cis Peptide Bond" information available for 1K3E)

(no "SAP(SNP)/Variant" information available for 1K3E)

(no "PROSITE Motif" information available for 1K3E)

(no "Exon" information available for 1K3E)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:141
 aligned with CEST_ECO57 | P58233 from UniProtKB/Swiss-Prot  Length:156

    Alignment length:146
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140      
           CEST_ECO57     1 MSSRSELLLEKFAEKIGIGSISFNENRLCSFAIDEIYYISLSDANDEYMMIYGVCGKFPTDNSNFALEILNANLWFAENGGPYLCYEAGAQSLLLALRFPLDDATPEKLENEIEVVVKSMENLYLVLHNQGITLENEHMKIEEISS 146
               SCOP domains d1k3ea_ A: Secretion chaperone CesT                                                                                                                SCOP domains
               CATH domains 1k3eA01 A:1-34,A:140-146          1k3eA02 A:35-134  [code=3.30.1460.10, no name defined]                                              -----1k3eA01 CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhh............eeee....eeeee.....eeeeeeeeee....hhhhhhhhhhhhhhhhhh...eeeee....eeeeeeeee....hhhhhhhhhhhhhhhhhhhhhhhhh.....-----.eeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1k3e A   1 MSSRSELLLEKFAEKIGIGSISFNENRLCSFAIDEIYYISLSDANDEYMMIYGVCGKFPTDNSNFALEILNANLWFAENGGPYLCYEAGAQSLLLALRFPLDDATPEKLENEIEVVVKSMENLYLVLHNQGITL-----KIEEISS 146
                                    10        20        30        40        50        60        70        80        90       100       110       120       130   |   140      
                                                                                                                                                               134   140

Chain A from PDB  Type:PROTEIN  Length:141
 aligned with CEST_ECOLX | Q47015 from UniProtKB/Swiss-Prot  Length:156

    Alignment length:146
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140      
           CEST_ECOLX     1 MSSRSELLLDRFAEKIGIGSISFNENRLCSFAIDEIYYISLSDANDEYMMIYGVCGKFPTDNPNFALEILNANLWFAENGGPYLCYESGAQSLLLALRFPLDDATPEKLENEIEVVVKSMENLYLVLHNQGITLENEHMKIEEISS 146
               SCOP domains d1k3ea_ A: Secretion chaperone CesT                                                                                                                SCOP domains
               CATH domains 1k3eA01 A:1-34,A:140-146          1k3eA02 A:35-134  [code=3.30.1460.10, no name defined]                                              -----1k3eA01 CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhh............eeee....eeeee.....eeeeeeeeee....hhhhhhhhhhhhhhhhhh...eeeee....eeeeeeeee....hhhhhhhhhhhhhhhhhhhhhhhhh.....-----.eeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1k3e A   1 MSSRSELLLEKFAEKIGIGSISFNENRLCSFAIDEIYYISLSDANDEYMMIYGVCGKFPTDNSNFALEILNANLWFAENGGPYLCYEAGAQSLLLALRFPLDDATPEKLENEIEVVVKSMENLYLVLHNQGITL-----KIEEISS 146
                                    10        20        30        40        50        60        70        80        90       100       110       120       130   |   140      
                                                                                                                                                               134   140

Chain B from PDB  Type:PROTEIN  Length:144
 aligned with CEST_ECO57 | P58233 from UniProtKB/Swiss-Prot  Length:156

    Alignment length:144
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142    
           CEST_ECO57     3 SRSELLLEKFAEKIGIGSISFNENRLCSFAIDEIYYISLSDANDEYMMIYGVCGKFPTDNSNFALEILNANLWFAENGGPYLCYEAGAQSLLLALRFPLDDATPEKLENEIEVVVKSMENLYLVLHNQGITLENEHMKIEEISS 146
               SCOP domains d1k3eb_ B: Secretion chaperone CesT                                                                                                              SCOP domains
               CATH domains 1k3eB01 B:3-34,B:140-145        1k3eB02 B:35-139  [code=3.30.1460.10, no name defined]                                                   1k3eB0- CATH domains
           Pfam domains (1) ----CesT-1k3eB01 B:7-124                                                                                                  ---------------------- Pfam domains (1)
           Pfam domains (2) ----CesT-1k3eB02 B:7-124                                                                                                  ---------------------- Pfam domains (2)
         Sec.struct. author ..hhhhhhhhhhhhh............eeeee...eeeee.....eeeeeeeeee....hhhhhhhhhhhhhhhhhh...eeeee....eeeeeeeee....hhhhhhhhhhhhhhhhhhhhhhhhh..........eeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1k3e B   3 SRSELLLEKFAEKIGIGSISFNENRLCSFAIDEIYYISLSDANDEYMMIYGVCGKFPTDNSNFALEILNANLWFAENGGPYLCYEAGAQSLLLALRFPLDDATPEKLENEIEVVVKSMENLYLVLHNQGITLENEHMKIEEISS 146
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142

Chain B from PDB  Type:PROTEIN  Length:144
 aligned with CEST_ECOLX | Q47015 from UniProtKB/Swiss-Prot  Length:156

    Alignment length:144
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142    
           CEST_ECOLX     3 SRSELLLDRFAEKIGIGSISFNENRLCSFAIDEIYYISLSDANDEYMMIYGVCGKFPTDNPNFALEILNANLWFAENGGPYLCYESGAQSLLLALRFPLDDATPEKLENEIEVVVKSMENLYLVLHNQGITLENEHMKIEEISS 146
               SCOP domains d1k3eb_ B: Secretion chaperone CesT                                                                                                              SCOP domains
               CATH domains 1k3eB01 B:3-34,B:140-145        1k3eB02 B:35-139  [code=3.30.1460.10, no name defined]                                                   1k3eB0- CATH domains
           Pfam domains (1) ----CesT-1k3eB01 B:7-124                                                                                                  ---------------------- Pfam domains (1)
           Pfam domains (2) ----CesT-1k3eB02 B:7-124                                                                                                  ---------------------- Pfam domains (2)
         Sec.struct. author ..hhhhhhhhhhhhh............eeeee...eeeee.....eeeeeeeeee....hhhhhhhhhhhhhhhhhh...eeeee....eeeeeeeee....hhhhhhhhhhhhhhhhhhhhhhhhh..........eeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1k3e B   3 SRSELLLEKFAEKIGIGSISFNENRLCSFAIDEIYYISLSDANDEYMMIYGVCGKFPTDNSNFALEILNANLWFAENGGPYLCYEAGAQSLLLALRFPLDDATPEKLENEIEVVVKSMENLYLVLHNQGITLENEHMKIEEISS 146
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Secretion chaperone-like (60)

Superfamily: Type III secretory system chaperone-like (19)

Family: Type III secretory system chaperone (14)

Protein domain: Secretion chaperone CesT (1)

Escherichia coli [TaxId: 562] (1)

1a	d1k3ea_	A:
1b	d1k3eb_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Yope Regulator; Chain: A, (26)

Homologous Superfamily: [code=3.30.1460.10, no name defined] (12)

Escherichia coli. Organism_taxid: 562. Strain: ha1. (1)

1a	1k3eB02	B:35-139
1b	1k3eA02	A:35-134

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Helix Hairpins (718)

Homologous Superfamily: [code=1.10.287.390, no name defined] (1)

Escherichia coli. Organism_taxid: 562. Strain: ha1. (1)

2a	1k3eA01	A:1-34,A:140-146
2b	1k3eB01	B:3-34,B:140-145

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: TypeIII_Chap (8)

Family: CesT (7)

Escherichia coli O157:H7 (1)

1a	CesT-1k3eB01	B:7-124
1b	CesT-1k3eB02	B:7-124

Asymmetric Unit(hide GO term definitions)

Chain A,B (CEST_ECO57 | P58233)

molecular function
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0009405	pathogenesis	The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
	GO:0050708	regulation of protein secretion	Any process that modulates the frequency, rate or extent of the controlled release of a protein from a cell.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Chain A,B (CEST_ECOLX | Q47015)

biological process
	GO:0009405	pathogenesis	The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
	GO:0050708	regulation of protein secretion	Any process that modulates the frequency, rate or extent of the controlled release of a protein from a cell.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1k3e)

	Sites
(no "Sites" information available for 1k3e)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1k3e)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1k3e
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CEST_ECO57 \| P58233
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	CEST_ECOLX \| Q47015
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CEST_ECO57 \| P58233
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	CEST_ECOLX \| Q47015
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 1K3E)

(no "Related Entries Specified in the PDB File" available for 1K3E)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (2, 4)

Pfam Domains (1, 2)

Gene Ontology (4, 7)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File