|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1K0S) |
Sites (0, 0)| (no "Site" information available for 1K0S) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1K0S) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1K0S) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1K0S) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1K0S) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:151 aligned with CHEW_THEMA | Q56311 from UniProtKB/Swiss-Prot Length:151 Alignment length:151 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 CHEW_THEMA 1 MKTLADALKEFEVLSFEIDEQALAFDVDNIEMVIEKSDITPVPKSRHFVEGVINLRGRIIPVVNLAKILGISFDEQKMKSIIVARTKDVEVGFLVDRVLGVLRITENQLDLTNVSDKFGKKSKGLVKTDGRLIIYLDIDKIIEEITVKEGV 151 SCOP domains d1k0sa_ A: Chemotaxis protein CheW SCOP domains CATH domains -------1k0sA01 SH3 Domains --------------------------------------------------------------------1k0sA01 A:8-28,A:97-136 SH3 Domains --------------- CATH domains Pfam domains -----------CheW-1k0sA01 A:12-146 ----- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------CHEW PDB: A:10-147 UniProt: 10-147 ---- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1k0s A 1 MKTLADALKEFEVLSFEIDEQALAFDVDNIEMVIEKSDITPVPKSRHFVEGVINLRGRIIPVVNLAKILGISFDEQKMKSIIVARTKDVEVGFLVDRVLGVLRITENQLDLTNVSDKFGKKSKGLVKTDGRLIIYLDIDKIIEEITVKEGV 151 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (4, 4)|
NMR Structure(hide GO term definitions) Chain A (CHEW_THEMA | Q56311)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|