Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  RNASE-RELATED PROTEIN FROM CALYSTEGIA SEPIUM
 
Authors :  A. Rabijns, C. Verboven, P. Rouge, A. Barre, E. J. M. Van Damme, W. J. Peumans, C. J. De Ranter
Date :  11 Sep 01  (Deposition) - 10 Apr 02  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.05
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Rnase, Alpha-Beta Protein, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Rabijns, C. Verboven, P. Rouge, A. Barre, E. J. Van Damme, W. J. Peumans, C. J. De Ranter
Structure Of An Rnase-Related Protein From Calystegia Sepium.
Acta Crystallogr. , Sect. D V. 58 627 2002
PubMed-ID: 11914487  |  Reference-DOI: 10.1107/S090744490200255X
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CALSEPRRP
    Chains: A, B
    Fragment: RESIDUES 1-212
    Organism Common: HEDGE BINDWEED
    Organism Scientific: CALYSTEGIA SEPIUM
    Organism Taxid: 47519
    Synonym: RNASE-LIKE PROTEIN

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1JY5)

(-) Sites  (0, 0)

(no "Site" information available for 1JY5)

(-) SS Bonds  (12, 12)

Asymmetric Unit
No.Residues
1A:19 -A:31
2A:26 -A:84
3A:57 -A:90
4A:58 -A:108
5A:170 -A:198
6A:181 -A:191
7B:19 -B:31
8B:26 -B:84
9B:57 -B:90
10B:58 -B:108
11B:170 -B:198
12B:181 -B:191

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Ser A:110 -Pro A:111
2Ser B:110 -Pro B:111

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1JY5)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1JY5)

(-) Exons   (0, 0)

(no "Exon" information available for 1JY5)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:203
 aligned with Q9M7C7_CALSE | Q9M7C7 from UniProtKB/TrEMBL  Length:253

    Alignment length:207
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       
         Q9M7C7_CALSE    30 HKEFDYFTLALTWSGTECLSVKDSCPTNACSRSEVETGFTIKGLWPDYDDGTWPSCCEGAKYDENEISILSNDLSKYWPSYSCMSSSACGSFDASDLAYEWAKHGTCSSPVLGNQYEYFSTALMLYFKYNISEILSESGYLPSNTAEYKLEGIMSAIQSALRVTPVVKCKSDAVEQVQICFDKTLQLQECPSTASTCPSLVSLPIKN 236
               SCOP domains d1jy5a_ A: RNase-re    lated protein                                                                                                                                                                            SCOP domains
               CATH domains 1jy5A00 A:2-208 Rib    onuclease Rh; Chain A                                                                                                                                                                    CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeeeehhhhh.----....hhhhh......eeeeeeeee...............hhhhhhhhhhhhhhhh.......eee..eee.hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh..........eehhhhhhhhhhhhh...eeeee..eeeeeeeee.....ee...........ee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1jy5 A   2 HKEFDYFTLALTWSGTECL----SCPTNACSRSEVETGFTIKGLWPDYDDGTWPSCCEGAKYDQNEISILSNDLSKYWPSYSCPSSSACGSFDASDLAYEWAKHGTCSSPVLGNQYEYFSTTLMLYFKYNISEILSESGYLPSNTAEYKVEGIMSAIQSALRVTPVVKCKSDAVEQVQICFDKTLQLQECPSTASTCPSLVSLPIKN 208
                                    11        |-   |    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       
                                             20   25                                                                                                                                                                                       


Chain B from PDB  Type:PROTEIN  Length:203
 aligned with Q9M7C7_CALSE | Q9M7C7 from UniProtKB/TrEMBL  Length:253

    Alignment length:207
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       
         Q9M7C7_CALSE    30 HKEFDYFTLALTWSGTECLSVKDSCPTNACSRSEVETGFTIKGLWPDYDDGTWPSCCEGAKYDENEISILSNDLSKYWPSYSCMSSSACGSFDASDLAYEWAKHGTCSSPVLGNQYEYFSTALMLYFKYNISEILSESGYLPSNTAEYKLEGIMSAIQSALRVTPVVKCKSDAVEQVQICFDKTLQLQECPSTASTCPSLVSLPIKN 236
               SCOP domains d1jy5b_ B: RNase-re    lated protein                                                                                                                                                                            SCOP domains
               CATH domains 1jy5B00 B:2-208 Rib    onuclease Rh; Chain A                                                                                                                                                                    CATH domains
           Pfam domains (1) ---Ribonuclease_T2-    1jy5B01 B:5-193                                                                                                                                                          --------------- Pfam domains (1)
           Pfam domains (2) ---Ribonuclease_T2-    1jy5B02 B:5-193                                                                                                                                                          --------------- Pfam domains (2)
         Sec.struct. author .....eeeeeeeehhhhh.----....hhhhh......eeeeeeeee...............hhhhhhhhhhhhhhhh.......eee..eee.hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.....eeeeeeehhhhhhhhhhhhh...eeee....eeeeeeee.....ee...........eeee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1jy5 B   2 HKEFDYFTLALTWSGTECL----SCPTNACSRSEVETGFTIKGLWPDYDDGTWPSCCEGAKYDQNEISILSNDLSKYWPSYSCPSSSACGSFDASDLAYEWAKHGTCSSPVLGNQYEYFSTTLMLYFKYNISEILSESGYLPSNTAEYKVEGIMSAIQSALRVTPVVKCKSDAVEQVQICFDKTLQLQECPSTASTCPSLVSLPIKN 208
                                    11        |-   |    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       
                                             20   25
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: no clan defined [family: Ribonuclease_T2] (11)

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q9M7C7_CALSE | Q9M7C7)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0033897    ribonuclease T2 activity    Catalysis of the two-stage endonucleolytic cleavage to nucleoside 3'-phosphates and 3'-phosphooligonucleotides with 2',3'-cyclic phosphate intermediates.
biological process
    GO:0090502    RNA phosphodiester bond hydrolysis, endonucleolytic    The chemical reactions and pathways involving the hydrolysis of internal 3',5'-phosphodiester bonds in one or two strands of ribonucleotides.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1jy5)
 
  Sites
(no "Sites" information available for 1jy5)
 
  Cis Peptide Bonds
    Ser A:110 - Pro A:111   [ RasMol ]  
    Ser B:110 - Pro B:111   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1jy5
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9M7C7_CALSE | Q9M7C7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9M7C7_CALSE | Q9M7C7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1JY5)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1JY5)