1JW3 - JenaLib

Title :   SOLUTION STRUCTURE OF METHANOBACTERIUM THERMOAUTOTROPHICUM PROTEIN 1598. ONTARIO CENTRE FOR STRUCTURAL PROTEOMICS TARGET MTH1598_1_140; NORTHEAST STRUCTURAL GENOMICS TARGET TT6

Authors :   X. Chang, G. Connelly, A. Yee, M. A. Kennedy, A. M. Edwards, C. H. Arrowsmith, Northeast Structural Genomics Consortium (Nesg)

Date :   02 Sep 01 (Deposition) - 27 Feb 02 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (10x)

Keywords :   Mth1598, Hypothetical Protein, Structural Genomics, Protein Structure Initiative, Ocsp, Nesg, Beta-Alpha-Beta Sandwich Fold, Psi, Northeast Structural Genomics Consortium, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. Yee, X. Chang, A. Pineda-Lucena, B. Wu, A. Semesi, B. Le, T. Ramelot, G. M. Lee, S. Bhattacharyya, P. Gutierrez, A. Denisov, C. H. Lee, J. R. Cort, G. Kozlov, J. Liao, G. Finak, L. Chen, D. Wishart, W. Lee, L. P. Mcintosh, K. Gehring, M. A. Kennedy, A. M. Edwards, C. H. Arrowsmith
An Nmr Approach To Structural Proteomics.
Proc. Natl. Acad. Sci. Usa V. 99 1825 2002
PubMed-ID: 11854485 | Reference-DOI: 10.1073/PNAS.042684599
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:140
 aligned with ARCH_METTH | O27635 from UniProtKB/Swiss-Prot  Length:140

    Alignment length:140
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140
           ARCH_METTH     1 MKGFEFFDVTADAGFWAYGHDLEEVFENAALAMFEVMTDTSLVEAAEERRVEITSEDRVSLLYDWLDELLFIHDTEFILFSKFKVKIDEKDDGLHLTGTAMGEEIKEGHERRDEVKAVTFHMMEILDEDGLIKARVILDL 140
               SCOP domains d1jw3a_ A: Hypothetical protein MTH1598                                                                                                      SCOP domains
               CATH domains 1jw3A00 A:1-140  [code=3.55.10.10, no name defined]                                                                                          CATH domains
               Pfam domains ---Archease-1jw3A01 A:4-140                                                                                                                  Pfam domains
         Sec.struct. author ...eee.....eeeeeee...hhhhhhhhhhhhhhhhh.........eeeeeeee..hhhhhhhhhhhhhhhhhhh.......eeeeee....eeeeeeee......................eeeee..eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1jw3 A   1 MKGFEFFDVTADAGFWAYGHDLEEVFENAALAMFEVMTDTSLVEAAEERRVEITSEDRVSLLYDWLDELLFIHDTEFILFSKFKVKIDEKDDGLHLTGTAMGEEIKEGHERRDEVKAVTFHMMEILDEDGLIKARVILDL 140
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (4, 4)

NMR Structure(hide GO term definitions)

Chain A (ARCH_METTH | O27635)

molecular function
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0008033	tRNA processing	The process in which a pre-tRNA molecule is converted to a mature tRNA, ready for addition of an aminoacyl group.
	GO:0006388	tRNA splicing, via endonucleolytic cleavage and ligation	Splicing of tRNA substrates via recognition of the folded RNA structure that brings the 5' and 3' splice sites into proximity and cleavage of the RNA at both the 3' and 5' splice sites by an endonucleolytic mechanism, followed by ligation of the exons.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1jw3)

	Sites
(no "Sites" information available for 1jw3)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1jw3)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1jw3
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ARCH_METTH \| O27635
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ARCH_METTH \| O27635
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description