1JSS - JenaLib

Title :   CRYSTAL STRUCTURE OF THE MUS MUSCULUS CHOLESTEROL-REGULATED START PROTEIN 4 (STARD4).

Authors :   M. J. Romanowski, R. E. Soccio, J. L. Breslow, S. K. Burley, New York Sgx Research Center For Structural Genomics (Nysgxrc)

Date :   17 Aug 01 (Deposition) - 10 Apr 02 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.20

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Start Domain, Structural Genomics, Psi, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Nysgxrc, Lipid Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. J. Romanowski, R. E. Soccio, J. L. Breslow, S. K. Burley
Crystal Structure Of The Mus Musculus Cholesterol-Regulated Start Protein 4 (Stard4) Containing A Star-Related Lipid Transfer Domain.
Proc. Natl. Acad. Sci. Usa V. 99 6949 2002
PubMed-ID: 12011453 | Reference-DOI: 10.1073/PNAS.052140699
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 4)

Asymmetric Unit (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_STAR4_MOUSE_001 *	K	41	E	STAR4_MOUSE	---	---	A/B	E	41	E
2	UniProt	VAR_STAR4_MOUSE_002 *	V	51	A	STAR4_MOUSE	---	---	A/B	A	51	A
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_STAR4_MOUSE_001 *	K	41	E	STAR4_MOUSE	---	---	A	E	41	E
2	UniProt	VAR_STAR4_MOUSE_002 *	V	51	A	STAR4_MOUSE	---	---	A	A	51	A
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_STAR4_MOUSE_001 *	K	41	E	STAR4_MOUSE	---	---	B	E	41	E
2	UniProt	VAR_STAR4_MOUSE_002 *	V	51	A	STAR4_MOUSE	---	---	B	A	51	A
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:199
 aligned with STAR4_MOUSE | Q99JV5 from UniProtKB/Swiss-Prot  Length:224

    Alignment length:199
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213         
          STAR4_MOUSE    24 ASISTKLQNTLIQYHSIKEDEWRVAKKVKDVTVWRKPSEEFNGYLYKAQGVMDDVVNNVIDHIRPGPWRLDWDRLMTSLDVLEHFEENCCVMRYTTAGQLLNIISPREFVDFSYTVGYEEGLLSCGVSVEWSETRPEFVRGYNHPCGWFCVPLKDSPSQSLLTGYIQTDLRGMIPQSAVDTAMASTLANFYSDLRKGLR 222
               SCOP domains d1jssa_ A: Cholesterol-regulated Start protein 4 (Stard4).                                                                                                                                              SCOP domains
               CATH domains 1jssA00 A:24-222  [code=3.30.530.20, no name defined]                                                                                                                                                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhheeeeee..eeeeeee......eeeeeeeee..hhhhhhhhhh...hhhhhh..eeeeeeeee....eeeeeeee..........eeeeeeeeeeee..eeeeeeee..........ee.ee..eeeeeeee..eeeeeeeeeee.ee.....hhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -----------------E---------A--------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------START  PDB: A:34-222 UniProt: 34-224                                                                                                                                                          PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1jss A  24 ASISTKLQNTLIQYHSIEEDEWRVAKKAKDVTVWRKPSEEFNGYLYKAQGVMDDVVNNVIDHIRPGPWRLDWDRLMTSLDVLEHFEENCCVMRYTTAGQLLNIISPREFVDFSYTVGYEEGLLSCGVSVEWSETRPEFVRGYNHPCGWFCVPLKDSPSQSLLTGYIQTDLRGMIPQSAVDTAMASTLANFYSDLRKGLR 222
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213

Chain B from PDB  Type:PROTEIN  Length:199
 aligned with STAR4_MOUSE | Q99JV5 from UniProtKB/Swiss-Prot  Length:224

    Alignment length:199
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213         
          STAR4_MOUSE    24 ASISTKLQNTLIQYHSIKEDEWRVAKKVKDVTVWRKPSEEFNGYLYKAQGVMDDVVNNVIDHIRPGPWRLDWDRLMTSLDVLEHFEENCCVMRYTTAGQLLNIISPREFVDFSYTVGYEEGLLSCGVSVEWSETRPEFVRGYNHPCGWFCVPLKDSPSQSLLTGYIQTDLRGMIPQSAVDTAMASTLANFYSDLRKGLR 222
               SCOP domains d1jssb_ B: Cholesterol-regulated Start protein 4 (Stard4).                                                                                                                                              SCOP domains
               CATH domains 1jssB00 B:24-222  [code=3.30.530.20, no name defined]                                                                                                                                                   CATH domains
           Pfam domains (1) -START-1jssB01 B:25-222                                                                                                                                                                                 Pfam domains (1)
           Pfam domains (2) -START-1jssB02 B:25-222                                                                                                                                                                                 Pfam domains (2)
         Sec.struct. author .hhhhhhhhhhhhhh.......eeeeee..eeeeeee......eeeeeeeee..hhhhhhhhhh...hhhhhh..eeeeeeeeeee..eeeeeeee..........eeeeeeeeeeee..eeeeeeee..........ee.ee..eeeeeee.......eeeeeee.ee.....hhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -----------------E---------A--------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------START  PDB: B:34-222 UniProt: 34-224                                                                                                                                                          PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1jss B  24 ASISTKLQNTLIQYHSIEEDEWRVAKKAKDVTVWRKPSEEFNGYLYKAQGVMDDVVNNVIDHIRPGPWRLDWDRLMTSLDVLEHFEENCCVMRYTTAGQLLNIISPREFVDFSYTVGYEEGLLSCGVSVEWSETRPEFVRGYNHPCGWFCVPLKDSPSQSLLTGYIQTDLRGMIPQSAVDTAMASTLANFYSDLRKGLR 222
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 2)

Gene Ontology (8, 8)

Asymmetric Unit(hide GO term definitions)

Chain A,B (STAR4_MOUSE | Q99JV5)

molecular function
	GO:0015485	cholesterol binding	Interacting selectively and non-covalently with cholesterol (cholest-5-en-3-beta-ol); the principal sterol of vertebrates and the precursor of many steroids, including bile acids and steroid hormones.
	GO:0008289	lipid binding	Interacting selectively and non-covalently with a lipid.
biological process
	GO:0034435	cholesterol esterification	A lipid modification process in which a sterol ester is formed by the combination of a carboxylic acid (often a fatty acid) and cholesterol. In the blood this process is associated with the conversion of free cholesterol into cholesteryl ester, which is then sequestered into the core of a lipoprotein particle.
	GO:0006869	lipid transport	The directed movement of lipids into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Lipids are compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1jss)

	Sites
(no "Sites" information available for 1jss)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1jss)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1jss
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	STAR4_MOUSE \| Q99JV5
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description