|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 5)| Asymmetric Unit (3, 5) Biological Unit 1 (2, 8) |
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1JQW) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1JQW) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1JQW) |
Exons (0, 0)| (no "Exon" information available for 1JQW) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:150 aligned with LUXS_BACSU | O34667 from UniProtKB/Swiss-Prot Length:157 Alignment length:150 17 27 37 47 57 67 77 87 97 107 117 127 137 147 157 LUXS_BACSU 8 ELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGCQTGYYLVVSGEPTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG 157 SCOP domains d1jqwa_ A: Autoinducer-2 production protein LuxS SCOP domains CATH domains 1jqwA00 A:8-157 [code=3.30.1360.80, no name defined] CATH domains Pfam domains LuxS-1jqwA01 A:8-156 - Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1jqw A 8 ELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGcQTGYYLVVSGETTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG 157 17 27 37 47 57 67 77 | 87 97 107 117 127 137 147 157 84-OCS
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (6, 6)|
Asymmetric Unit(hide GO term definitions) Chain A (LUXS_BACSU | O34667)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|