|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 4) Biological Unit 1 (2, 2) Biological Unit 2 (1, 2) |
Asymmetric Unit (5, 5)
|
Asymmetric Unit
|
Asymmetric Unit
|
(no "SAP(SNP)/Variant" information available for 1JQ8) |
Asymmetric Unit (2, 4)
|
(no "Exon" information available for 1JQ8) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:121 aligned with PA2B8_DABRR | P59071 from UniProtKB/Swiss-Prot Length:121 Alignment length:121 10 20 30 40 50 60 70 80 90 100 110 120 PA2B8_DABRR 1 SLLEFGKMILEETGKLAIPSYSSYGCYCGWGGKGTPKDATDRCCFVHDCCYGNLPDCNPKSDRYKYKRVNGAIVCEKGTSCENRICECDKAAAICFRQNLNTYSKKYMLYPDFLCKGELKC 121 SCOP domains d1jq8a_ A: Snake phospholipase A2 SCOP domains CATH domains 1jq8A00 A:1-133 Phospholipase A2 CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------PA2_HIS ----------------------------------PA2_ASP -------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------- Transcript 1jq8 A 1 SLLEFGKMILEETGKLAIPSYSSYGCYCGWGGKGTPKDATDRCCFVHDCCYGNLPDCNPKSDRYKYKRVNGAIVCEKGTSCENRICECDKAAAICFRQNLNTYSKKYMLYPDFLCKGELKC 133 10 || 21 31 41 51 ||||69 79 ||90 100 110 120 || 131| 14| 56||| 86| 122| 131| 16 59|| 88 124 133 61| 67 Chain B from PDB Type:PROTEIN Length:121 aligned with PA2B8_DABRR | P59071 from UniProtKB/Swiss-Prot Length:121 Alignment length:121 10 20 30 40 50 60 70 80 90 100 110 120 PA2B8_DABRR 1 SLLEFGKMILEETGKLAIPSYSSYGCYCGWGGKGTPKDATDRCCFVHDCCYGNLPDCNPKSDRYKYKRVNGAIVCEKGTSCENRICECDKAAAICFRQNLNTYSKKYMLYPDFLCKGELKC 121 SCOP domains d1jq8b_ B: Snake phospholipase A2 SCOP domains CATH domains 1jq8B00 B:1-133 Phospholipase A2 CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------PA2_HIS ----------------------------------PA2_ASP -------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------- Transcript 1jq8 B 1 SLLEFGKMILEETGKLAIPSYSSYGCYCGWGGKGTPKDATDRCCFVHDCCYGNLPDCNPKSDRYKYKRVNGAIVCEKGTSCENRICECDKAAAICFRQNLNTYSKKYMLYPDFLCKGELKC 133 10 || 21 31 41 51 ||||69 79 ||90 100 110 120 || 131| 14| 56||| 86| 122| 131| 16 59|| 88 124 133 61| 67 Chain P from PDB Type:PROTEIN Length:5 SCOP domains ----- SCOP domains CATH domains ----- CATH domains Pfam domains ----- Pfam domains SAPs(SNPs) ----- SAPs(SNPs) PROSITE ----- PROSITE Transcript ----- Transcript 1jq8 P 1 LAIYS 5
|
Asymmetric Unit
|
Asymmetric Unit |
(no "Pfam Domain" information available for 1JQ8) |
Asymmetric Unit(hide GO term definitions) Chain A,B (PA2B8_DABRR | P59071)
|
|
|
|
|
|
|