Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  MUTATION THAT DESTABILIZE THE GP41 CORE: DETERMINANTS FOR STABILIZING THE SIV/CPMAC ENVELOPE GLYCOPROTEIN COMPLEX. WILD TYPE.
 
Authors :  J. Liu, S. Wang, C. C. Labranche, J. A. Hoxie, M. Lu
Date :  03 Aug 01  (Deposition) - 24 Apr 02  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym. Unit :  A,D,G
Biol. Unit 1:  A  (3x)
Biol. Unit 2:  D  (3x)
Biol. Unit 3:  G  (3x)
Keywords :  Gp41, Siv, Hiv-1, Membrane Fusion, Six-Helix Bundle, Trimer-Of- Hairpins, Viral Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Liu, S. Wang, J. A. Hoxie, C. C. Labranche, M. Lu
Mutations That Destabilize The Gp41 Core Are Determinants For Stabilizing The Simian Immunodeficiency Virus-Cpmac Envelope Glycoprotein Complex.
J. Biol. Chem. V. 277 12891 2002
PubMed-ID: 11830586  |  Reference-DOI: 10.1074/JBC.M110315200

(-) Compounds

Molecule 1 - GP41 ENVELOPE PROTEIN
    Chains: A, D, G
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Expression System Vector Type: PLASMID
    Fragment: N40(L6)C38
    Organism Scientific: SIMIAN IMMUNODEFICIENCY VIRUS
    Organism Taxid: 11723
    Strain: MAC251
    Synonym: ENVELOPE GLYCOPROTEIN

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit : ADG
Biological Unit 1 (3x): A  
Biological Unit 2 (3x):  D 
Biological Unit 3 (3x):   G

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1JPX)

(-) Sites  (0, 0)

(no "Site" information available for 1JPX)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1JPX)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1JPX)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1JPX)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1JPX)

(-) Exons   (0, 0)

(no "Exon" information available for 1JPX)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:59
 aligned with Q87972_SIV | Q87972 from UniProtKB/TrEMBL  Length:366

    Alignment length:109
                                    56        66        76        86        96       106       116       126       136       146         
           Q87972_SIV    47 GIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTAIEKYLKDQAQLNAWGCAFRQVCHTTVPWPNASLTPNWNNDTWQEWERKVDFLEENITALLEEAQIQQEKNMYE 155
               SCOP domains d1jpxa_ A: Retrovius gp41 pr                                                  otease-resistant core           SCOP domains
               CATH domains 1jpxA00 A:6-78  [code=1.10.2                                                  87.210, no name defined]        CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhh--------------------------------------------------.hhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------- Transcript
                 1jpx A   6 GIVQQQQQLLDVVKRQQELLRLTVWGTK--------------------------------------------------QEWERKVDFLEENITALLEEAQIQQEKNMYE  78
                                    15        25       | -         -         -         -         -        49        59        69         
                                                      33                                                 48                              


Chain D from PDB  Type:PROTEIN  Length:57
 aligned with Q87972_SIV | Q87972 from UniProtKB/TrEMBL  Length:366

    Alignment length:108
                                    56        66        76        86        96       106       116       126       136       146        
           Q87972_SIV    47 GIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTAIEKYLKDQAQLNAWGCAFRQVCHTTVPWPNASLTPNWNNDTWQEWERKVDFLEENITALLEEAQIQQEKNMY 154
               SCOP domains d1jpxd_ D: Retrovius gp41 pr                                                   otease-resistant core         SCOP domains
               CATH domains 1jpxD00 D:6-77  [code=1.10.2                                                   87.210, no name defined]      CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhh---------------------------------------------------hhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------ Transcript
                 1jpx D   6 GIVQQQQQLLDVVKRQQELLRLTVWGTK---------------------------------------------------EWERKVDFLEENITALLEEAQIQQEKNMY  77
                                    15        25       | -         -         -         -         -        49        59        69        
                                                      33                                                  49                            


Chain G from PDB  Type:PROTEIN  Length:56
 aligned with Q87972_SIV | Q87972 from UniProtKB/TrEMBL  Length:366

    Alignment length:106
                                    56        66        76        86        96       106       116       126       136       146      
           Q87972_SIV    47 GIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTAIEKYLKDQAQLNAWGCAFRQVCHTTVPWPNASLTPNWNNDTWQEWERKVDFLEENITALLEEAQIQQEKN 152
               SCOP domains d1jpxg_ G: Retrovius gp41 pr                                                  otease-resistant core        SCOP domains
               CATH domains 1jpxG00 G:6-75  [code=1.10.2                                                  87.210, no name defined]     CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhh--------------------------------------------------.hhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 1jpx G   6 GIVQQQQQLLDVVKRQQELLRLTVWGTK--------------------------------------------------QEWERKVDFLEENITALLEEAQIQQEKN  75
                                    15        25       | -         -         -         -         -        49        59        69      
                                                      33                                                 48
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric Unit
(-)
Class: Coiled coil proteins (689)

(-) CATH Domains  (1, 3)

Asymmetric Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1JPX)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)
Chain A,D,G   (Q87972_SIV | Q87972)
molecular function
    GO:0005198    structural molecule activity    The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0019031    viral envelope    The lipid bilayer of a virion that surrounds the protein capsid. May also contain glycoproteins.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1jpx)
 
  Sites
(no "Sites" information available for 1jpx)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1jpx)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1jpx
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q87972_SIV | Q87972
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q87972_SIV | Q87972
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1JPX)

(-) Related Entries Specified in the PDB File

1jq0 1JQ0 IS THE MUTANT VERSION OF THIS ENTRY.
1qbz