|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1JOS) |
Sites (0, 0)| (no "Site" information available for 1JOS) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1JOS) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1JOS) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1JOS) |
PROSITE Motifs (1, 1)
Asymmetric/Biological Unit (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1JOS) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:100 aligned with RBFA_HAEIN | P45141 from UniProtKB/Swiss-Prot Length:128 Alignment length:100 16 26 36 46 56 66 76 86 96 106 RBFA_HAEIN 7 RSDRVAQEIQKEIAVILQREVKDPRIGMVTVSDVEVSSDLSYAKIFVTFLFDHDEMAIEQGMKGLEKASPYIRSLLGKAMRLRIVPEIRFIYDQSLVEGM 106 SCOP domains d1josa_ A: Ribosome-binding factor A, RbfA SCOP domains CATH domains 1josA00 A:7-106 [code=3.30.300.20, no name defined] CATH domains Pfam domains ---------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -----------------------------------------------------------------------RBFA PDB: A:78-99 ------- PROSITE Transcript ---------------------------------------------------------------------------------------------------- Transcript 1jos A 7 RSDRVAQEIQKEIAVILQREVKDPRIGMVTVSDVEVSSDLSYAKIFVTFLFDHDEMAIEQGMKGLEKASPYIRSLLGKAMRLRIVPEIRFIYDQSLVEGM 106 16 26 36 46 56 66 76 86 96 106
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1JOS) |
Gene Ontology (2, 2)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (RBFA_HAEIN | P45141)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|