Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE CYTOPLASMIC N-TERMINUS OF THE BK BETA-SUBUNIT KCNMB2
 
Authors :  D. Bentrop, M. Beyermann, R. Wissmann, B. Fakler
Date :  27 Jul 01  (Deposition) - 16 Nov 01  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (24x)
Keywords :  Helix, Ion Channel, Cytoplasmic Part Of, Metal Transport, Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. Bentrop, M. Beyermann, R. Wissmann, B. Fakler
Nmr Structure Of The "Ball-And-Chain" Domain Of Kcnmb2, The Beta 2-Subunit Of Large Conductance Ca2+- And Voltage-Activated Potassium Channels.
J. Biol. Chem. V. 276 42116 2001
PubMed-ID: 11517232  |  Reference-DOI: 10.1074/JBC.M107118200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - POTASSIUM LARGE CONDUCTANCE CALCIUM-ACTIVATED CHANNEL, SUBFAMILY M, BETA MEMBER 2
    Chains: A
    Engineered: YES
    Fragment: CYTOPLASMIC N-TERMINUS OF KCNMB2, RESIDUES 1-45
    Other Details: THE 45-RESIDUE PEPTIDE WAS SYNTHESIZED BY STANDARD SOLID-PHASE SYNTHESIS. THE SEQUENCE OCCURS NATURALLY IN HUMANS.
    Synonym: KCNMB2
    Synthetic: YES

 Structural Features

(-) Chains, Units

  
NMR Structure (24x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1JO6)

(-) Sites  (0, 0)

(no "Site" information available for 1JO6)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1JO6)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1JO6)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1JO6)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1JO6)

(-) Exons   (2, 2)

NMR Structure (2, 2)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.5aENST000003583165aENSE00001629212chr3:178525083-178525253171KCMB2_HUMAN1-19191A:1-1919
1.8bENST000003583168bENSE00001703074chr3:178543376-178543546171KCMB2_HUMAN19-76581A:19-4527
1.9dENST000003583169dENSE00001329034chr3:178545966-178546161196KCMB2_HUMAN76-141660--
1.10cENST0000035831610cENSE00001306968chr3:178560441-1785622051765KCMB2_HUMAN142-235940--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:45
 aligned with KCMB2_HUMAN | Q9Y691 from UniProtKB/Swiss-Prot  Length:235

    Alignment length:45
                                    10        20        30        40     
           KCMB2_HUMAN    1 MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGED 45
               SCOP domains d1jo6a_ A:                                    SCOP domains
               CATH domains 1jo6A00 A:1-45                                CATH domains
               Pfam domains KcnmB2_inactiv-1jo6A02 A:1-32   CaKB-1jo6A01  Pfam domains
         Sec.struct. author ....................hhhhhhhhhh............... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5a          -------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------Exon 1.8b  PDB: A:19-45     Transcript 1 (2)
                  1jo6 A  1 MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGED 45
                                    10        20        30        40
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Peptides (792)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Few Secondary Structures (1120)

(-) Pfam Domains  (2, 2)

NMR Structure
(-)
Clan: no clan defined [family: CaKB] (1)
(-)
Clan: no clan defined [family: KcnmB2_inactiv] (1)

(-) Gene Ontology  (17, 17)

NMR Structure(hide GO term definitions)
Chain A   (KCMB2_HUMAN | Q9Y691)
molecular function
    GO:0015269    calcium-activated potassium channel activity    Enables the calcium concentration-regulatable energy-independent passage of potassium ions across a lipid bilayer down a concentration gradient.
    GO:0008200    ion channel inhibitor activity    Stops, prevents, or reduces the activity of an ion channel.
    GO:0015459    potassium channel regulator activity    Modulates potassium channel activity via direct interaction interaction with a potassium channel (binding or modification).
biological process
    GO:0001508    action potential    A process in which membrane potential cycles through a depolarizing spike, triggered in response to depolarization above some threshold, followed by repolarization. This cycle is driven by the flow of ions through various voltage gated channels with different thresholds and ion specificities.
    GO:0007268    chemical synaptic transmission    The vesicular release of classical neurotransmitter molecules from a presynapse, across a chemical synapse, the subsequent activation of neurotransmitter receptors at the postsynapse of a target cell (neuron, muscle, or secretory cell) and the effects of this activation on the postsynaptic membrane potential and ionic composition of the postsynaptic cytosol. This process encompasses both spontaneous and evoked release of neurotransmitter and all parts of synaptic vesicle exocytosis. Evoked transmission starts with the arrival of an action potential at the presynapse.
    GO:0005513    detection of calcium ion    The series of events in which a calcium ion stimulus is received by a cell and converted into a molecular signal.
    GO:0006811    ion transport    The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0019228    neuronal action potential    An action potential that occurs in a neuron.
    GO:0071805    potassium ion transmembrane transport    A process in which a potassium ion is transported from one side of a membrane to the other.
    GO:0006813    potassium ion transport    The directed movement of potassium ions (K+) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0019229    regulation of vasoconstriction    Any process that modulates the frequency, rate or extent of reductions in the diameter of blood vessels.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0008076    voltage-gated potassium channel complex    A protein complex that forms a transmembrane channel through which potassium ions may cross a cell membrane in response to changes in membrane potential.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1jo6)
 
  Sites
(no "Sites" information available for 1jo6)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1jo6)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1jo6
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KCMB2_HUMAN | Q9Y691
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  KCMB2_HUMAN | Q9Y691
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        KCMB2_HUMAN | Q9Y691: 1jak

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1JO6)