|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1JNS) |
Sites (0, 0)| (no "Site" information available for 1JNS) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1JNS) |
Cis Peptide Bonds (1, 18)
NMR Structure
|
||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1JNS) |
PROSITE Motifs (2, 2)
NMR Structure (2, 2)
|
||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1JNS) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:92 aligned with PPIC_ECOLI | P0A9L5 from UniProtKB/Swiss-Prot Length:93 Alignment length:92 11 21 31 41 51 61 71 81 91 PPIC_ECOLI 2 AKTAAALHILVKEEKLALDLLEQIKNGADFGKLAKKHSICPSGKRGGDLGEFRQGQMVPAFDKVVFSCPVLEPTGPLHTQFGYHIIKVLYRN 93 SCOP domains d1jnsa_ A: Parvulin 10 (rotamase C) SCOP domains CATH domains 1jnsA00 A:1-92 [code=3.10.50.40, no name defined] CATH domains Pfam domains -------Rotamase-1jnsA01 A:8-90 -- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) PPIC_PPIASE_2 PDB: A:1-90 UniProt: 2-91 -- PROSITE (1) PROSITE (2) -----------------------------PPIC_PPIASE_1 ------------------------------------------ PROSITE (2) Transcript -------------------------------------------------------------------------------------------- Transcript 1jns A 1 AKTAAALHILVKEEKLALDLLEQIKNGADFGKLAKKHSICPSGKRGGDLGEFRQGQMVPAFDKVVFSCPVLEPTGPLHTQFGYHIIKVLYRN 92 10 20 30 40 50 60 70 80 90
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A (PPIC_ECOLI | P0A9L5)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|