|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
Asymmetric/Biological Unit (1, 2)
|
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1JNI) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1JNI) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1JNI) |
PROSITE Motifs (1, 1)
Asymmetric/Biological Unit (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1JNI) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:64 aligned with NAPB_HAEIN | P44654 from UniProtKB/Swiss-Prot Length:150 Alignment length:68 72 82 92 102 112 122 NAPB_HAEIN 63 NQPPMVPHSVANYQVTKNVNQCLNCHSPENSRLSGATRISPTHFMDRDGKVGSSSSPRRYFCLQCHVS 130 SCOP domains d1jnia_ A: Periplasmic nitrate reductase subunit Na pB SCOP domains CATH domains 1jniA00 A:37-104 CATH domains Pfam domains NapB-1jniA01 A:37-104 Pfam domains SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------MULTIHEME_CYTC PDB: A:53-104 UniProt: 79-133 PROSITE Transcript -------------------------------------------------------------------- Transcript 1jni A 37 NQPPMVPHSVANYQVTKNVNQCLNCHSPENSRLSGATRISPTHFMDRDGKV----SPRRYFCLQCHVS 104 46 56 66 76 86| | 96 87 92
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (1, 1)| Asymmetric/Biological Unit |
Gene Ontology (3, 3)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (NAPB_HAEIN | P44654)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|