Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  UNEXPECTED FORMATION OF AN EPOXIDE-DERIVED MULTISUBSTRATE ADDUCT INHIBITOR ON THE ACTIVE SITE OF GAR TRANSFORMYLASE
 
Authors :  S. E. Greasley, T. H. Marsilje, H. Cai, S. Baker, S. J. Benkovic, D. L. Boger, I. A. Wilson
Date :  13 Jul 01  (Deposition) - 30 Nov 01  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Keywords :  Purine Biosynthesis, Anti-Cancer Agent, Enzyme-Assembled Multisubstrate Adduct Inhibitor Complex, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. E. Greasley, T. H. Marsilje, H. Cai, S. Baker, S. J. Benkovic, D. L. Boger, I. A. Wilson
Unexpected Formation Of An Epoxide-Derived Multisubstrate Adduct Inhibitor On The Active Site Of Gar Transformylase.
Biochemistry V. 40 13538 2001
PubMed-ID: 11695901  |  Reference-DOI: 10.1021/BI011482+
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE
    ChainsA, B, C, D
    EC Number2.1.2.2
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPJS167
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentTRANSFERASE
    GenePURN
    Organism ScientificESCHERICHIA COLI
    Organism Taxid562
    SynonymGLYCINAMIDE RIBONUCLEOTIDE TRANSFORMYLASE;
GART

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)AB  
Biological Unit 2 (1x)  CD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric Unit (1, 4)
No.NameCountTypeFull Name
11384Ligand/IonN-[5'-O-PHOSPHONO-RIBOFURANOSYL]-2-[2-HYDROXY-2-[4-[GLUTAMIC ACID]-N-CARBONYLPHENYL]-3-[2-AMINO-4-HYDROXY-QUINAZOLIN-6-YL]-PROPANYLAMINO]-ACETAMIDE
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
11382Ligand/IonN-[5'-O-PHOSPHONO-RIBOFURANOSYL]-2-[2-HYDROXY-2-[4-[GLUTAMIC ACID]-N-CARBONYLPHENYL]-3-[2-AMINO-4-HYDROXY-QUINAZOLIN-6-YL]-PROPANYLAMINO]-ACETAMIDE
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
11382Ligand/IonN-[5'-O-PHOSPHONO-RIBOFURANOSYL]-2-[2-HYDROXY-2-[4-[GLUTAMIC ACID]-N-CARBONYLPHENYL]-3-[2-AMINO-4-HYDROXY-QUINAZOLIN-6-YL]-PROPANYLAMINO]-ACETAMIDE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASN A:10 , GLY A:11 , SER A:12 , ASN A:13 , ARG A:64 , GLY A:87 , PHE A:88 , MET A:89 , ARG A:90 , ILE A:91 , LEU A:92 , VAL A:97 , ILE A:107 , HIS A:108 , PRO A:109 , VAL A:139 , GLN A:170 , GLU A:173 , HOH A:1222 , HOH A:1223 , HOH A:1230 , HOH A:1233 , HOH A:1236 , HOH A:1238 , HOH A:1240 , HOH A:1241 , HOH A:1242 , HOH A:1308 , HOH A:1320 , HOH A:1330 , HOH A:1344 , HOH A:1387 , LYS C:153BINDING SITE FOR RESIDUE 138 A 1221
2AC2SOFTWAREASN B:10 , GLY B:11 , SER B:12 , ASN B:13 , LYS B:37 , ARG B:64 , GLY B:87 , PHE B:88 , MET B:89 , ARG B:90 , ILE B:91 , LEU B:92 , VAL B:97 , ILE B:107 , HIS B:108 , PRO B:109 , VAL B:139 , GLU B:173 , HOH B:2227 , HOH B:2231 , HOH B:2233 , HOH B:2240 , HOH B:2246 , HOH B:2251 , HOH B:2255 , HOH B:2266 , HOH B:2278 , HOH B:2288 , HOH B:2307 , HOH B:2342 , HOH B:2384 , GLU D:131 , LYS D:153BINDING SITE FOR RESIDUE 138 B 2221
3AC3SOFTWAREASN C:10 , GLY C:11 , SER C:12 , ASN C:13 , ARG C:64 , GLY C:87 , PHE C:88 , MET C:89 , ARG C:90 , ILE C:91 , LEU C:92 , VAL C:97 , ILE C:107 , HIS C:108 , PRO C:109 , VAL C:139 , GLN C:170 , GLU C:173 , HOH C:3224 , HOH C:3234 , HOH C:3248 , HOH C:3259 , HOH C:3266 , HOH C:3270 , HOH C:3280 , HOH C:3286 , HOH C:3292 , HOH C:3319 , HOH C:3339 , HOH C:3365 , HOH C:3366BINDING SITE FOR RESIDUE 138 C 3221
4AC4SOFTWAREGLU B:131 , ASN D:10 , GLY D:11 , SER D:12 , ASN D:13 , ARG D:64 , GLY D:87 , PHE D:88 , MET D:89 , ARG D:90 , ILE D:91 , LEU D:92 , VAL D:97 , ILE D:107 , HIS D:108 , PRO D:109 , VAL D:139 , GLU D:173 , HOH D:4224 , HOH D:4227 , HOH D:4230 , HOH D:4237 , HOH D:4261 , HOH D:4262 , HOH D:4277 , HOH D:4283 , HOH D:4326 , HOH D:4327 , HOH D:4328BINDING SITE FOR RESIDUE 138 D 4221

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1JKX)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Leu A:112 -Pro A:113
2Leu B:112 -Pro B:113
3Leu C:112 -Pro C:113
4Leu D:112 -Pro D:113

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1JKX)

(-) PROSITE Motifs  (1, 4)

Asymmetric Unit (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GARTPS00373 Phosphoribosylglycinamide formyltransferase active site.PUR3_ECOLI133-156
 
 
 
  4A:133-156
B:133-156
C:133-156
D:133-156
Biological Unit 1 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GARTPS00373 Phosphoribosylglycinamide formyltransferase active site.PUR3_ECOLI133-156
 
 
 
  2A:133-156
B:133-156
-
-
Biological Unit 2 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GARTPS00373 Phosphoribosylglycinamide formyltransferase active site.PUR3_ECOLI133-156
 
 
 
  2-
-
C:133-156
D:133-156

(-) Exons   (0, 0)

(no "Exon" information available for 1JKX)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:209
 aligned with PUR3_ECOLI | P08179 from UniProtKB/Swiss-Prot  Length:212

    Alignment length:209
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200         
           PUR3_ECOLI     1 MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDSREAYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPSLLPKYPGLHTHRQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYA 209
               SCOP domains d1jkxa_ A: Glycinamide ribonucleotide transformylase, GART                                                                                                                                                        SCOP domains
               CATH domains 1jkxA00 A:1-209  [code=3.40.50.170, no name defined]                                                                                                                                                              CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee...hhhhhhhhhhhhh.....eeeeeee....hhhhhhhhhh..eeee.hhhhh.hhhhhhhhhhhhhhhhh..eeee.......hhhhhhhh...eeeee..........hhhhhhhhh...eeeeeeee.........eeeeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhh..eeee..eeee..ee....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------GART  PDB: A:133-156    ----------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1jkx A   1 MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDSREAYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPSLLPKYPGLHTHRQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYA 209
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200         

Chain B from PDB  Type:PROTEIN  Length:209
 aligned with PUR3_ECOLI | P08179 from UniProtKB/Swiss-Prot  Length:212

    Alignment length:209
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200         
           PUR3_ECOLI     1 MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDSREAYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPSLLPKYPGLHTHRQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYA 209
               SCOP domains d1jkxb_ B: Glycinamide ribonucleotide transformylase, GART                                                                                                                                                        SCOP domains
               CATH domains 1jkxB00 B:1-209  [code=3.40.50.170, no name defined]                                                                                                                                                              CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee...hhhhhhhhhhhhh.....eeeeeee....hhhhhhhhhh..eeee.hhhhh.hhhhhhhhhhhhhhhhh..eeee.......hhhhhhhh...eeeee..........hhhhhhhhh...eeeeeeee.........eeeeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhh..eeee..eeee..ee....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------GART  PDB: B:133-156    ----------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1jkx B   1 MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDSREAYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPSLLPKYPGLHTHRQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYA 209
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200         

Chain C from PDB  Type:PROTEIN  Length:209
 aligned with PUR3_ECOLI | P08179 from UniProtKB/Swiss-Prot  Length:212

    Alignment length:209
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200         
           PUR3_ECOLI     1 MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDSREAYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPSLLPKYPGLHTHRQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYA 209
               SCOP domains d1jkxc_ C: Glycinamide ribonucleotide transformylase, GART                                                                                                                                                        SCOP domains
               CATH domains 1jkxC00 C:1-209  [code=3.40.50.170, no name defined]                                                                                                                                                              CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee...hhhhhhhhhhhhh.....eeeeeee....hhhhhhhhhh..eeee.hhhhh.hhhhhhhhhhhhhhhhh..eeee.......hhhhhhhh...eeeee..........hhhhhhhhhh..eeeeeeee.........eeeeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhh..eee....eee..ee....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------GART  PDB: C:133-156    ----------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1jkx C   1 MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDSREAYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPSLLPKYPGLHTHRQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYA 209
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200         

Chain D from PDB  Type:PROTEIN  Length:209
 aligned with PUR3_ECOLI | P08179 from UniProtKB/Swiss-Prot  Length:212

    Alignment length:209
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200         
           PUR3_ECOLI     1 MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDSREAYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPSLLPKYPGLHTHRQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYA 209
               SCOP domains d1jkxd_ D: Glycinamide ribonucleotide transformylase, GART                                                                                                                                                        SCOP domains
               CATH domains 1jkxD00 D:1-209  [code=3.40.50.170, no name defined]                                                                                                                                                              CATH domains
           Pfam domains (1) Formyl_trans_N-1jkxD01 D:1-181                                                                                                                                                       ---------------------------- Pfam domains (1)
           Pfam domains (2) Formyl_trans_N-1jkxD02 D:1-181                                                                                                                                                       ---------------------------- Pfam domains (2)
           Pfam domains (3) Formyl_trans_N-1jkxD03 D:1-181                                                                                                                                                       ---------------------------- Pfam domains (3)
           Pfam domains (4) Formyl_trans_N-1jkxD04 D:1-181                                                                                                                                                       ---------------------------- Pfam domains (4)
         Sec.struct. author .eeeeee...hhhhhhhhhhhhh.....eeeeeee.....hhhhhhhhh..eeee.hhhhh.hhhhhhhhhhhhhhhhh..eeee.......hhhhhhhh...eeeee..........hhhhhhhhh...eeeeeeee.........eeeeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhh..eee....eee..ee....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------GART  PDB: D:133-156    ----------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1jkx D   1 MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDSREAYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPSLLPKYPGLHTHRQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYA 209
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit

(-) CATH Domains  (1, 4)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 4)

Asymmetric Unit

(-) Gene Ontology  (8, 8)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (PUR3_ECOLI | P08179)
molecular function
    GO:0016742    hydroxymethyl-, formyl- and related transferase activity    Catalysis of the transfer of a hydroxymethyl- or formyl group from one compound (donor) to another (acceptor).
    GO:0004644    phosphoribosylglycinamide formyltransferase activity    Catalysis of the reaction: 10-formyltetrahydrofolate + N1-(5-phospho-D-ribosyl)glycinamide = tetrahydrofolate + N2-formyl-N1-(5-phospho-D-ribosyl)glycinamide.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0006189    'de novo' IMP biosynthetic process    The chemical reactions and pathways resulting in the formation of IMP, inosine monophosphate, by the stepwise assembly of a purine ring on ribose 5-phosphate.
    GO:0009058    biosynthetic process    The chemical reactions and pathways resulting in the formation of substances; typically the energy-requiring part of metabolism in which simpler substances are transformed into more complex ones.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    GO:0006164    purine nucleotide biosynthetic process    The chemical reactions and pathways resulting in the formation of a purine nucleotide, a compound consisting of nucleoside (a purine base linked to a deoxyribose or ribose sugar) esterified with a phosphate group at either the 3' or 5'-hydroxyl group of the sugar.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    138  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Leu A:112 - Pro A:113   [ RasMol ]  
    Leu B:112 - Pro B:113   [ RasMol ]  
    Leu C:112 - Pro C:113   [ RasMol ]  
    Leu D:112 - Pro D:113   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1jkx
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PUR3_ECOLI | P08179
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.1.2.2
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PUR3_ECOLI | P08179
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PUR3_ECOLI | P081791c2t 1c3e 1cdd 1cde 1gar 1grc 2gar 3gar

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1JKX)