Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE DETERMINATION OF ASPARTATE RACEMASE FROM AN ARCHAEA
 
Authors :  L. J. Liu, K. Iwata, A. Kita, Y. Kawarabayasi, M. Yohda, K. Miki
Date :  21 Jun 01  (Deposition) - 05 Jun 02  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Alpha-Beta Structure, Homo-Dimer, Homologous Domains, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. Liu, K. Iwata, A. Kita, Y. Kawarabayasi, M. Yohda, K. Miki
Crystal Structure Of Aspartate Racemase From Pyrococcus Horikoshii Ot3 And Its Implications For Molecular Mechanism Of Plp-Independent Racemization.
J. Mol. Biol. V. 319 479 2002
PubMed-ID: 12051922  |  Reference-DOI: 10.1016/S0022-2836(02)00296-6

(-) Compounds

Molecule 1 - ASPARTATE RACEMASE
    ChainsA, B
    EC Number5.1.1.13
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET23C
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GenePH0670
    Organism ScientificPYROCOCCUS HORIKOSHII
    Organism Taxid70601
    StrainOT3

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1JFL)

(-) Sites  (0, 0)

(no "Site" information available for 1JFL)

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:73 -B:73

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Met A:10 -Gly A:11
2Met B:10 -Gly B:11

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1JFL)

(-) PROSITE Motifs  (2, 4)

Asymmetric/Biological Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ASP_GLU_RACEMASE_1PS00923 Aspartate and glutamate racemases signature 1.RACD_PYRHO79-87
 
  2A:79-87
B:79-87
2ASP_GLU_RACEMASE_2PS00924 Aspartate and glutamate racemases signature 2.RACD_PYRHO190-200
 
  2A:190-200
B:190-200

(-) Exons   (0, 0)

(no "Exon" information available for 1JFL)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:228
 aligned with RACD_PYRHO | O58403 from UniProtKB/Swiss-Prot  Length:228

    Alignment length:228
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220        
           RACD_PYRHO     1 MKTIGILGGMGPLATAELFRRIVIKTPAKRDQEHPKVIIFNNPQIPDRTAYILGKGEDPRPQLIWTAKRLEECGADFIIMPCNTAHAFVEDIRKAIKIPIISMIEETAKKVKELGFKKAGLLATTGTIVSGVYEKEFSKYGVEIMTPTEDEQKDVMRGIYEGVKAGNLKLGRELLLKTAKILEERGAECIIAGCTEVSVVLKQDDLKVPLIDPMDVIAEVAVKVALEK 228
               SCOP domains d1jfla1 A:1-115 Aspartate racemase                                                                                 d1jfla2 A:116-228 Aspartate racemase                                                                              SCOP domains
               CATH domains 1jflA01 A:1-104,A:214-228  [code=3.40.50.1860, no name defined]                                         1jflA02 A:105-213  [code=3.40.50.1860, no name defined]                                                      1jflA01         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeee..hhhhhhhhhhhhhhh....hhhhh..eeeee.....hhhhhhh.....hhhhhhhhhhhhhhhh..eee...hhhhhhhhhhhhhh.....hhhhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhhhh..eee..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee.hhhhhhhhhhhhh...eehhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------ASP_GLU_R------------------------------------------------------------------------------------------------------ASP_GLU_RAC---------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1jfl A   1 MKTIGILGGMGPLATAELFRRIVIKTPAKRDQEHPKVIIFNNPQIPDRTAYILGKGEDPRPQLIWTAKRLEECGADFIIMPCNTAHAFVEDIRKAIKIPIISMIEETAKKVKELGFKKAGLLATTGTIVSGVYEKEFSKYGVEIMTPTEDEQKDVMRGIYEGVKAGNLKLGRELLLKTAKILEERGAECIIAGCTEVSVVLKQDDLKVPLIDPMDVIAEVAVKVALEK 228
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220        

Chain B from PDB  Type:PROTEIN  Length:228
 aligned with RACD_PYRHO | O58403 from UniProtKB/Swiss-Prot  Length:228

    Alignment length:228
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220        
           RACD_PYRHO     1 MKTIGILGGMGPLATAELFRRIVIKTPAKRDQEHPKVIIFNNPQIPDRTAYILGKGEDPRPQLIWTAKRLEECGADFIIMPCNTAHAFVEDIRKAIKIPIISMIEETAKKVKELGFKKAGLLATTGTIVSGVYEKEFSKYGVEIMTPTEDEQKDVMRGIYEGVKAGNLKLGRELLLKTAKILEERGAECIIAGCTEVSVVLKQDDLKVPLIDPMDVIAEVAVKVALEK 228
               SCOP domains d1jflb1 B:1-115 Aspartate racemase                                                                                 d1jflb2 B:116-228 Aspartate racemase                                                                              SCOP domains
               CATH domains 1jflB01 B:1-104,B:214-228  [code=3.40.50.1860, no name defined]                                         1jflB02 B:105-213  [code=3.40.50.1860, no name defined]                                                      1jflB01         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeee..hhhhhhhhhhhhhhh....hhhhh..eeeee.....hhhhhhh.....hhhhhhhhhhhhhhhh..eee...hhhhhhhhhhhhhh.....hhhhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhhhh..eee..hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh....eee.hhhhhhhhhhhhh...eehhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------ASP_GLU_R------------------------------------------------------------------------------------------------------ASP_GLU_RAC---------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1jfl B   1 MKTIGILGGMGPLATAELFRRIVIKTPAKRDQEHPKVIIFNNPQIPDRTAYILGKGEDPRPQLIWTAKRLEECGADFIIMPCNTAHAFVEDIRKAIKIPIISMIEETAKKVKELGFKKAGLLATTGTIVSGVYEKEFSKYGVEIMTPTEDEQKDVMRGIYEGVKAGNLKLGRELLLKTAKILEERGAECIIAGCTEVSVVLKQDDLKVPLIDPMDVIAEVAVKVALEK 228
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1JFL)

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (RACD_PYRHO | O58403)
molecular function
    GO:0047689    aspartate racemase activity    Catalysis of the reaction: L-aspartate = D-aspartate.
    GO:0016853    isomerase activity    Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
    GO:0036361    racemase activity, acting on amino acids and derivatives    Catalysis of the interconversion of the two enantiomers of a chiral amino acid or amino acid derivative.
    GO:0016855    racemase and epimerase activity, acting on amino acids and derivatives    Catalysis of a reaction that alters the configuration of one or more chiral centers in an amino acid.
biological process
    GO:0006520    cellular amino acid metabolic process    The chemical reactions and pathways involving amino acids, carboxylic acids containing one or more amino groups, as carried out by individual cells.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0006807    nitrogen compound metabolic process    The chemical reactions and pathways involving organic or inorganic compounds that contain nitrogen.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1jfl)
 
  Sites
(no "Sites" information available for 1jfl)
 
  Cis Peptide Bonds
    Met A:10 - Gly A:11   [ RasMol ]  
    Met B:10 - Gly B:11   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1jfl
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RACD_PYRHO | O58403
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  5.1.1.13
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RACD_PYRHO | O58403
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RACD_PYRHO | O584031iu9 2dx7

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1JFL)