Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE HYPOTHETICAL PROTEIN MJ1247 FROM METHANOCOCCUS JANNASCHII AT 2.0 A RESOLUTION INFERS A MOLECULAR FUNCTION OF 3-HEXULOSE-6-PHOSPHATE ISOMERASE.
 
Authors :  L. A. Martinez-Cruz, M. K. Dreyer, D. C. Boisvert, H. Yokota, M. L. Marti Chantar, R. Kim, S. H. Kim, Berkeley Structural Genomics Center (
Date :  18 Jun 01  (Deposition) - 20 Feb 02  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  A  (4x)
Keywords :  Rump Pathway, Phosphosugar, 3-Hexulose-6-Phosphate Isomerase, Phi, Structural Genomics, Bsgc Structure Funded By Nih, Protein Structure Initiative, Psi, Berkeley Structural Genomics Center, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. A. Martinez-Cruz, M. K. Dreyer, D. C. Boisvert, H. Yokota, M. L. Martinez-Chantar, R. Kim, S. H. Kim
Crystal Structure Of Mj1247 Protein From M. Jannaschii At 2. 0 A Resolution Infers A Molecular Function Of 3-Hexulose-6-Phosphate Isomerase.
Structure V. 10 195 2002
PubMed-ID: 11839305  |  Reference-DOI: 10.1016/S0969-2126(02)00701-3

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN MJ1247
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidSJS1244
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneMJ1247
    Organism ScientificMETHANOCALDOCOCCUS JANNASCHII
    Organism Taxid2190
    SynonymMJ1247

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (1x)A
Biological Unit 2 (4x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 4)

Asymmetric Unit (2, 4)
No.NameCountTypeFull Name
1CIT1Ligand/IonCITRIC ACID
2CME3Mod. Amino AcidS,S-(2-HYDROXYETHYL)THIOCYSTEINE
Biological Unit 1 (2, 4)
No.NameCountTypeFull Name
1CIT1Ligand/IonCITRIC ACID
2CME3Mod. Amino AcidS,S-(2-HYDROXYETHYL)THIOCYSTEINE
Biological Unit 2 (2, 16)
No.NameCountTypeFull Name
1CIT4Ligand/IonCITRIC ACID
2CME12Mod. Amino AcidS,S-(2-HYDROXYETHYL)THIOCYSTEINE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREVAL A:48 , SER A:51 , SER A:90 , GLY A:91 , SER A:92 , THR A:95 , HIS A:176 , HOH A:3006 , HOH A:3031 , HOH A:3045 , HOH A:3046 , HOH A:3048 , HOH A:3067 , HOH A:3068 , HOH A:3070 , HOH A:3071BINDING SITE FOR RESIDUE CIT A 3000

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1JEO)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1JEO)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1JEO)

(-) PROSITE Motifs  (1, 1)

Asymmetric Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SISPS51464 SIS domain profile.PHI_METJA33-167  1A:33-167
Biological Unit 1 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SISPS51464 SIS domain profile.PHI_METJA33-167  1A:33-167
Biological Unit 2 (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SISPS51464 SIS domain profile.PHI_METJA33-167  4A:33-167

(-) Exons   (0, 0)

(no "Exon" information available for 1JEO)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:177
 aligned with PHI_METJA | Q58644 from UniProtKB/Swiss-Prot  Length:180

    Alignment length:177
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       
            PHI_METJA     4 LEELDIVSNNILILKKFYTNDEWKNKLDSLIDRIIKAKKIFIFGVGRSGYIGRCFAMRLMHLGFKSYFVGETTTPSYEKDDLLILISGSGRTESVLTVAKKAKNINNNIIAIVCECGNVVEFADLTIPLEVKKSKYLPMGTTFEETALIFLDLVIAEIMKRLNLDESEIIKRHCNLL 180
               SCOP domains d1jeoa_ A: Probable 3-hexulose-6-phosphate isomerase MJ1247                                                                                                                       SCOP domains
               CATH domains 1jeoA00 A:4-180 Glucose-6-phosphate isomerase like protein; domain 1                                                                                                              CATH domains
               Pfam domains --------------------------------SIS-1jeoA01 A:36-158                                                                                                       ---------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh..eeee.hhhhhhhhhhhhhhhhhh...eee.............eeeee.....hhhhhhhhhhhhh....eeeee...hhhhhhh.eeee...........hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------SIS  PDB: A:33-167 UniProt: 33-167                                                                                                     ------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1jeo A   4 LEELDIVSNNILILKKFYTNDEWKNKLDSLIDRIIKAKKIFIFGVGRSGYIGRCFAMRLMHLGFKSYFVGETTTPSYEKDDLLILISGSGRTESVLTVAKKAKNINNNIIAIVcEcGNVVEFADLTIPLEVKKSKYLPMGTTFEETALIFLDLVIAEIMKRLNLDESEIIKRHcNLL 180
                                    13        23        33        43        53        63        73        83        93       103       113   | | 123       133       143       153       163       173   |   
                                                                                                                                           117-CME                                                     177-CME
                                                                                                                                             119-CME                                                         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit

(-) CATH Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

Asymmetric Unit
(-)
Clan: SIS (53)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)
Chain A   (PHI_METJA | Q58644)
molecular function
    GO:0030246    carbohydrate binding    Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
    GO:0004360    glutamine-fructose-6-phosphate transaminase (isomerizing) activity    Catalysis of the reaction: beta-D-fructose 6-phosphate + L-glutamine = D-glucosamine 6-phosphate + L-glutamate.
    GO:0016853    isomerase activity    Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
biological process
    GO:0006047    UDP-N-acetylglucosamine metabolic process    The chemical reactions and pathways involving UDP-N-acetylglucosamine, a substance composed of N-acetylglucosamine, a common structural unit of oligosaccharides, in glycosidic linkage with uridine diphosphate.
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
    GO:0006002    fructose 6-phosphate metabolic process    The chemical reactions and pathways involving fructose 6-phosphate, also known as F6P. The D-enantiomer is an important intermediate in glycolysis, gluconeogenesis, and fructose metabolism.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CIT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CME  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1jeo)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1jeo
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PHI_METJA | Q58644
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PHI_METJA | Q58644
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1JEO)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1JEO)