Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF TM006 PROTEIN FROM THERMOTOGA MARITIMA
 
Authors :  A. Y. Denisov, G. Finak, A. Yee, G. Kozlov, K. Gehring, C. H. Arrowsmith
Date :  14 Jun 01  (Deposition) - 27 Feb 02  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Tm006, Thermotoga Maritima, Structural Genomics (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Yee, X. Chang, A. Pineda-Lucena, B. Wu, A. Semesi, B. Le, T. Ramelot, G. M. Lee, S. Bhattacharyya, P. Gutierrez, A. Denisov, C. H. Lee, J. R. Cort, G. Kozlov, J. Liao, G. Finak, L. Chen, D. Wishart, W. Lee, L. P. Mcintosh, K. Gehring, M. A. Kennedy, A. M. Edwards, C. H. Arrowsmith
An Nmr Approach To Structural Proteomics.
Proc. Natl. Acad. Sci. Usa V. 99 1825 2002
PubMed-ID: 11854485  |  Reference-DOI: 10.1073/PNAS.042684599
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN TM0983
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET15B
    Expression System Strain: BL21 GOLD MAGIC
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Organism Scientific: THERMOTOGA MARITIMA
    Organism Taxid: 2336
    Synonym: TM006 PROTEIN

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1JDQ)

(-) Sites  (0, 0)

(no "Site" information available for 1JDQ)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1JDQ)

(-) Cis Peptide Bonds  (3, 13)

NMR Structure
No.ModelResidues
15, 8, 13, 17, 18Cys A:36 -Pro A:37
25, 7, 12, 13, 20Tyr A:62 -Pro A:63
38, 12, 14Val A:14 -Pro A:15

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1JDQ)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UPF0033PS01148 Uncharacterized protein family UPF0033 signature.Y983_THEMA10-34  1A:29-53

(-) Exons   (0, 0)

(no "Exon" information available for 1JDQ)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:98
 aligned with Y983_THEMA | Q9X078 from UniProtKB/Swiss-Prot  Length:79

    Alignment length:98
                                               1                                                                              
                                     -         1        11        21        31        41        51        61        71        
            Y983_THEMA    - -------------------MAKYQVTKTLDVRGEVCPVPDVETKRALQNMKPGEILEVWIDYPMSKERIPETVKKLGHEVLEIEEVGPSEWKIYIKVK 79
               SCOP domains d1jdqa_ A: Hypothetical protein TM0983                                                             SCOP domains
               CATH domains 1jdqA00 A:1-98 SirA-like                                                                           CATH domains
               Pfam domains --------------------------SirA-1jdqA01 A:27-97                                                   - Pfam domains
         Sec.struct. author ..........................eeee......hhhhhhhhhhhhh.....eeeeee...hhhhhhhhhhhhh...eeeeee.....eeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------UPF0033  PDB: A:29-53    --------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------- Transcript
                  1jdq A  1 GSSHHHHHHSSGLVPRGSHMAKYQVTKTLDVRGEVCPVPDVETKRALQNMKPGEILEVWIDYPMSKERIPETVKKLGHEVLEIEEVGPSEWKIYIKVK 98
                                    10        20        30        40        50        60        70        80        90
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: SirA-like (4)

(-) Gene Ontology  (0, 0)

NMR Structure(hide GO term definitions)
    (no "Gene Ontology" information available for 1JDQ)

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1jdq)
 
  Sites
(no "Sites" information available for 1jdq)
 
  Cis Peptide Bonds
    Cys A:36 - Pro A:37   [ RasMol ]  
    Tyr A:62 - Pro A:63   [ RasMol ]  
    Val A:14 - Pro A:15   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1jdq
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Y983_THEMA | Q9X078
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Y983_THEMA | Q9X078
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1JDQ)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1JDQ)