1J96 - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   HUMAN 3ALPHA-HSD TYPE 3 IN TERNARY COMPLEX WITH NADP AND TESTOSTERONE

Authors :   V. Nahoum, F. Labrie, S. -X. Lin

Date :   23 May 01 (Deposition) - 23 May 02 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.25

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Aldo-Keto Reductase, Steroid Metabolism, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   V. Nahoum, A. Gangloff, P. Legrand, D. W. Zhu, L. Cantin, B. S. Zhorov, V. Luu-The, F. Labrie, R. Breton, S. X. Lin
Structure Of The Human 3Alpha-Hydroxysteroid Dehydrogenase Type 3 In Complex With Testosterone And Nadp At 1. 25-A Resolution.
J. Biol. Chem. V. 276 42091 2001
PubMed-ID: 11514561 | Reference-DOI: 10.1074/JBC.M105610200
(for further references see the PDB file header)

Molecule 1 - 3ALPHA-HYDROXYSTEROID DEHYDROGENASE TYPE 3
	Chains	:	A, B
	EC Number	:	1.1.1.213
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	3ALPHA-HYDROXYCHOLANATE DEHYDROGENASE

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (3, 6)

No.	Name	Count	Type	Full Name
1	ACT	2	Ligand/Ion	ACETATE ION
2	NAP	2	Ligand/Ion	NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
3	TES	2	Ligand/Ion	TESTOSTERONE

Biological Unit 1 (3, 3)

No.	Name	Count	Type	Full Name
1	ACT	1	Ligand/Ion	ACETATE ION
2	NAP	1	Ligand/Ion	NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
3	TES	1	Ligand/Ion	TESTOSTERONE

Biological Unit 2 (3, 3)

No.	Name	Count	Type	Full Name
1	ACT	1	Ligand/Ion	ACETATE ION
2	NAP	1	Ligand/Ion	NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
3	TES	1	Ligand/Ion	TESTOSTERONE

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	TYR A:55 , HIS A:117 , NAP A:901 , TES A:903 , HOH A:1093 , HOH A:1148	BINDING SITE FOR RESIDUE ACT A 905
2	AC2	SOFTWARE	TYR B:55 , HIS B:117 , NAP B:902 , TES B:904	BINDING SITE FOR RESIDUE ACT B 906
3	AC3	SOFTWARE	GLY A:22 , THR A:23 , TYR A:24 , ASP A:50 , TYR A:55 , LYS A:84 , HIS A:117 , SER A:166 , ASN A:167 , GLN A:190 , TYR A:216 , SER A:217 , ALA A:218 , LEU A:219 , GLY A:220 , SER A:221 , HIS A:222 , ALA A:253 , LEU A:268 , ALA A:269 , LYS A:270 , SER A:271 , TYR A:272 , ARG A:276 , GLN A:279 , ASN A:280 , LEU A:306 , ACT A:905 , HOH A:927 , HOH A:930 , HOH A:932 , HOH A:939 , HOH A:1008 , HOH A:1023 , HOH A:1071 , HOH A:1077 , HOH A:1093 , HOH A:1148 , HOH A:1177	BINDING SITE FOR RESIDUE NAP A 901
4	AC4	SOFTWARE	TYR A:24 , VAL A:54 , VAL A:128 , ILE A:129 , TRP A:227 , LEU A:306 , ACT A:905	BINDING SITE FOR RESIDUE TES A 903
5	AC5	SOFTWARE	GLY B:22 , THR B:23 , TYR B:24 , ASP B:50 , TYR B:55 , HIS B:117 , SER B:166 , ASN B:167 , GLN B:190 , TYR B:216 , SER B:217 , ALA B:218 , LEU B:219 , GLY B:220 , SER B:221 , HIS B:222 , ALA B:253 , LEU B:268 , LYS B:270 , SER B:271 , TYR B:272 , ARG B:276 , GLN B:279 , ASN B:280 , LEU B:306 , ACT B:906 , HOH B:925 , HOH B:949 , HOH B:999 , HOH B:1038 , HOH B:1074 , HOH B:1185 , HOH B:1199 , HOH B:1214	BINDING SITE FOR RESIDUE NAP B 902
6	AC6	SOFTWARE	TYR B:24 , VAL B:54 , VAL B:128 , ILE B:129 , TRP B:227 , LEU B:306 , ACT B:906	BINDING SITE FOR RESIDUE TES B 904

(no "SS Bond" information available for 1J96)

(no "Cis Peptide Bond" information available for 1J96)

Asymmetric Unit (6, 12)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_048216	F	46	Y	AK1C2_HUMAN	Polymorphism	2854482	A/B	F	46	Y
2	UniProt	VAR_066632	I	79	V	AK1C2_HUMAN	Disease (SRXY8)	387906750	A/B	I	79	V
3	UniProt	VAR_066633	H	90	Q	AK1C2_HUMAN	Disease (SRXY8)	797044460	A/B	H	90	Q
4	UniProt	VAR_014748	L	172	Q	AK1C2_HUMAN	Polymorphism	11474	A/B	L	172	Q
5	UniProt	VAR_066634	H	222	Q	AK1C2_HUMAN	Disease (SRXY8)	---	A/B	H	222	Q
6	UniProt	VAR_066635	N	300	T	AK1C2_HUMAN	Disease (SRXY8)	387906751	A/B	N	300	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (6, 6)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_048216	F	46	Y	AK1C2_HUMAN	Polymorphism	2854482	A	F	46	Y
2	UniProt	VAR_066632	I	79	V	AK1C2_HUMAN	Disease (SRXY8)	387906750	A	I	79	V
3	UniProt	VAR_066633	H	90	Q	AK1C2_HUMAN	Disease (SRXY8)	797044460	A	H	90	Q
4	UniProt	VAR_014748	L	172	Q	AK1C2_HUMAN	Polymorphism	11474	A	L	172	Q
5	UniProt	VAR_066634	H	222	Q	AK1C2_HUMAN	Disease (SRXY8)	---	A	H	222	Q
6	UniProt	VAR_066635	N	300	T	AK1C2_HUMAN	Disease (SRXY8)	387906751	A	N	300	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (6, 6)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_048216	F	46	Y	AK1C2_HUMAN	Polymorphism	2854482	B	F	46	Y
2	UniProt	VAR_066632	I	79	V	AK1C2_HUMAN	Disease (SRXY8)	387906750	B	I	79	V
3	UniProt	VAR_066633	H	90	Q	AK1C2_HUMAN	Disease (SRXY8)	797044460	B	H	90	Q
4	UniProt	VAR_014748	L	172	Q	AK1C2_HUMAN	Polymorphism	11474	B	L	172	Q
5	UniProt	VAR_066634	H	222	Q	AK1C2_HUMAN	Disease (SRXY8)	---	B	H	222	Q
6	UniProt	VAR_066635	N	300	T	AK1C2_HUMAN	Disease (SRXY8)	387906751	B	N	300	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ALDOKETO_REDUCTASE_2	PS00062	Aldo/keto reductase family signature 2.	AK1C2_HUMAN	151-168	2	A:151-168 B:151-168
2	ALDOKETO_REDUCTASE_3	PS00063	Aldo/keto reductase family putative active site signature.	AK1C2_HUMAN	268-283	2	A:268-283 B:268-283

Biological Unit 1 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ALDOKETO_REDUCTASE_2	PS00062	Aldo/keto reductase family signature 2.	AK1C2_HUMAN	151-168	1	A:151-168 -
2	ALDOKETO_REDUCTASE_3	PS00063	Aldo/keto reductase family putative active site signature.	AK1C2_HUMAN	268-283	1	A:268-283 -

Biological Unit 2 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ALDOKETO_REDUCTASE_2	PS00062	Aldo/keto reductase family signature 2.	AK1C2_HUMAN	151-168	1	- B:151-168
2	ALDOKETO_REDUCTASE_3	PS00063	Aldo/keto reductase family putative active site signature.	AK1C2_HUMAN	268-283	1	- B:268-283

Asymmetric Unit (9, 18)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.4a	ENST00000380753	4a	ENSE00002187446	chr10:5046215-5045944	272	AK1C2_HUMAN	1-28	28	2	A:1-28 B:1-28	28 28
1.5	ENST00000380753	5	ENSE00001613313	chr10:5043873-5043706	168	AK1C2_HUMAN	29-84	56	2	A:29-84 B:29-84	56 56
1.6b	ENST00000380753	6b	ENSE00001619656	chr10:5042858-5042742	117	AK1C2_HUMAN	85-123	39	2	A:85-123 B:85-123	39 39
1.6e	ENST00000380753	6e	ENSE00001705571	chr10:5041469-5041392	78	AK1C2_HUMAN	124-149	26	2	A:124-149 B:124-149 (gaps)	26 26
1.7b	ENST00000380753	7b	ENSE00001693200	chr10:5040939-5040817	123	AK1C2_HUMAN	150-190	41	2	A:150-190 B:150-190	41 41
1.8	ENST00000380753	8	ENSE00001714710	chr10:5038057-5037948	110	AK1C2_HUMAN	191-227	37	2	A:191-227 B:191-227	37 37
1.9b	ENST00000380753	9b	ENSE00001785365	chr10:5037676-5037511	166	AK1C2_HUMAN	227-282	56	2	A:227-282 B:227-282	56 56
1.10a	ENST00000380753	10a	ENSE00001601494	chr10:5034105-5034023	83	AK1C2_HUMAN	283-310	28	2	A:283-310 B:283-310	28 28
1.11c	ENST00000380753	11c	ENSE00001895645	chr10:5032230-5029967	2264	AK1C2_HUMAN	310-323	14	2	A:310-323 B:310-323	14 14

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:323
 aligned with AK1C2_HUMAN | P52895 from UniProtKB/Swiss-Prot  Length:323

    Alignment length:323
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320   
          AK1C2_HUMAN     1 MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY 323
               SCOP domains d1j96a_ A: 3-alpha-hydroxysteroid dehydrogenase                                                                                                                                                                                                                                                                                     SCOP domains
               CATH domains 1j96A00 A:1-323 NADP-dependent oxidoreductase                                                                                                                                                                                                                                                                                       CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eee.....eee.eeee........hhhhhhhhhhhhhhh..eee.hhhhhhhhhhhhhhhhhhhh...hhhhheeeeeehhhhhhhhhhhhhhhhhhhhhh...eeeeee..........................hhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhh.........eeeee......hhhhhhhhhhh..eeeee.................hhhhhhhhhhhhhhhh.hhhhhhhhhhhhh..eeeee..hhhhhhhhhhhhhh..hhhhhhhhhh.........hhhhh........... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------Y--------------------------------V----------Q---------------------------------------------------------------------------------Q-------------------------------------------------Q-----------------------------------------------------------------------------T----------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------ALDOKETO_REDUCTASE---------------------------------------------------------------------------------------------------ALDOKETO_REDUCTA---------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.4a  PDB: A:1-28      Exon 1.5  PDB: A:29-84 UniProt: 29-84                   Exon 1.6b  PDB: A:85-123               Exon 1.6e  PDB: A:124-149 Exon 1.7b  PDB: A:150-190                Exon 1.8  PDB: A:191-227             -------------------------------------------------------Exon 1.10a  PDB: A:283-310  ------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.9b  PDB: A:227-282 UniProt: 227-282              ---------------------------Exon 1.11c     Transcript 1 (2)
                 1j96 A   1 DDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY 323
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320

Chain B from PDB  Type:PROTEIN  Length:318
 aligned with AK1C2_HUMAN | P52895 from UniProtKB/Swiss-Prot  Length:323

    Alignment length:323
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320   
          AK1C2_HUMAN     1 MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY 323
               SCOP domains d1j96b_ B: 3-alpha-hydroxysteroid dehydrogenase                                                                                                                                                                                                                                                                                     SCOP domains
               CATH domains 1j96B00 B:1-323 NADP-dependent oxidoreductase                                                                                                                                                                                                                                                                                       CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eee.....eee.eeee........hhhhhhhhhhhhhhh..eee.hhhhhhhhhhhhhhhhhhhh...hhhhheeeeeehhhhhhhhhhhhhhhhhhhhhh...eeeeee...............-----......hhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhh.........eeeee......hhhhhhhhhhh..eeeee.................hhhhhhhhhhhhhhhh.hhhhhhhhhhhhh..eeeee..hhhhhhhhhhhhhh..hhhhhhhhhh.........hhhhh........... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------Y--------------------------------V----------Q---------------------------------------------------------------------------------Q-------------------------------------------------Q-----------------------------------------------------------------------------T----------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------ALDOKETO_REDUCTASE---------------------------------------------------------------------------------------------------ALDOKETO_REDUCTA---------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.4a  PDB: B:1-28      Exon 1.5  PDB: B:29-84 UniProt: 29-84                   Exon 1.6b  PDB: B:85-123               Exon 1.6e UniProt: 124-149Exon 1.7b  PDB: B:150-190                Exon 1.8  PDB: B:191-227             -------------------------------------------------------Exon 1.10a  PDB: B:283-310  ------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.9b  PDB: B:227-282 UniProt: 227-282              ---------------------------Exon 1.11c     Transcript 1 (2)
                 1j96 B   1 DDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPK-----ILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY 323
                                    10        20        30        40        50        60        70        80        90       100       110       120       130|     |140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320   
                                                                                                                                                            131   137

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: TIM beta/alpha-barrel (3956)

Superfamily: NAD(P)-linked oxidoreductase (286)

Family: Aldo-keto reductases (NADP) (251)

Protein domain: 3-alpha-hydroxysteroid dehydrogenase (15)

Human (Homo sapiens), type III [TaxId: 9606] (12)

1a	d1j96a_	A:
1b	d1j96b_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: Alpha-Beta Barrel (2994)

Topology: TIM Barrel (2806)

Homologous Superfamily: NADP-dependent oxidoreductase (181)

Human (Homo sapiens) (116)

1a	1j96B00	B:1-323
1b	1j96A00	A:1-323

(no "Pfam Domain" information available for 1J96)

Asymmetric Unit(hide GO term definitions)

Chain A,B (AK1C2_HUMAN | P52895)

molecular function
	GO:0004032	alditol:NADP+ 1-oxidoreductase activity	Catalysis of the reaction: an alditol + NADP+ = an aldose + NADPH + H+.
	GO:0032052	bile acid binding	Interacting selectively and non-covalently with bile acids, any of a group of steroid carboxylic acids occurring in bile.
	GO:0031406	carboxylic acid binding	Interacting selectively and non-covalently with a carboxylic acid, any organic acid containing one or more carboxyl (COOH) groups or anions (COO-).
	GO:0047086	ketosteroid monooxygenase activity	Catalysis of the reaction: O2 + NADPH + progesterone = H2O + NADP+ + testosterone acetate.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016655	oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor	Catalysis of an oxidation-reduction (redox) reaction in which NADH or NADPH acts as a hydrogen or electron donor and reduces a quinone or a similar acceptor molecule.
	GO:0018636	phenanthrene 9,10-monooxygenase activity	Catalysis of the reaction: phenanthrene + O2 + NADH + H+ = H2O + NAD+ + phenanthrene-9,10-oxide.
	GO:0047115	trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity	Catalysis of the reaction: NADP+ + trans-1,2-dihydrobenzene-1,2-diol = NADPH + catechol.
biological process
	GO:0007186	G-protein coupled receptor signaling pathway	A series of molecular signals that proceeds with an activated receptor promoting the exchange of GDP for GTP on the alpha-subunit of an associated heterotrimeric G-protein complex. The GTP-bound activated alpha-G-protein then dissociates from the beta- and gamma-subunits to further transmit the signal within the cell. The pathway begins with receptor-ligand interaction, or for basal GPCR signaling the pathway begins with the receptor activating its G protein in the absence of an agonist, and ends with regulation of a downstream cellular process, e.g. transcription. The pathway can start from the plasma membrane, Golgi or nuclear membrane (PMID:24568158 and PMID:16902576).
	GO:0071395	cellular response to jasmonic acid stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a jasmonic acid stimulus.
	GO:0071799	cellular response to prostaglandin D stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a prostagladin D stimulus.
	GO:0044597	daunorubicin metabolic process	The chemical reactions and pathways involving daunorubicin, a chemotherapeutic of the anthracycline family that is given as a treatment for some types of cancer.
	GO:0007586	digestion	The whole of the physical, chemical, and biochemical processes carried out by multicellular organisms to break down ingested nutrients into components that may be easily absorbed and directed into metabolism.
	GO:0044598	doxorubicin metabolic process	The chemical reactions and pathways involving doxorubicin, an anthracycline antibiotic, used in cancer chemotherapy.
	GO:0030855	epithelial cell differentiation	The process in which a relatively unspecialized cell acquires specialized features of an epithelial cell, any of the cells making up an epithelium.
	GO:0006629	lipid metabolic process	The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0051897	positive regulation of protein kinase B signaling	Any process that activates or increases the frequency, rate or extent of protein kinase B signaling, a series of reactions mediated by the intracellular serine/threonine kinase protein kinase B.
	GO:0042448	progesterone metabolic process	The chemical reactions and pathways involving progesterone, a steroid hormone produced in the ovary which prepares and maintains the uterus for pregnancy. Also found in plants.
	GO:0006693	prostaglandin metabolic process	The chemical reactions and pathways involving prostaglandins, any of a group of biologically active metabolites which contain a cyclopentane ring due to the formation of a bond between two carbons of a fatty acid. They have a wide range of biological activities.
	GO:0008202	steroid metabolic process	The chemical reactions and pathways involving steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		ACT	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NAP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		TES	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1j96)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1j96
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	AK1C2_HUMAN \| P52895
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.1.1.213
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	614279
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	AK1C2_HUMAN \| P52895
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 1J96)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 6)

Sites (6, 6)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (6, 12)

PROSITE Motifs (2, 4)

Exons (9, 18)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (23, 23)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File