1J7V - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Title :   HUMAN IL-10 / IL-10R1 COMPLEX

Authors :   K. Josephson, N. Logsdon, M. R. Walter

Date :   18 May 01 (Deposition) - 19 Sep 01 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.90

Chains :   Asym. Unit : L,R
Biol. Unit 1: L,R  (2x)

Keywords :   Cytokine Receptor Complex, 4 Helix Bundle, Class 2 Receptor, Interleukin-10, Cytokine/Receptor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   K. Josephson, N. J. Logsdon, M. R. Walter
Crystal Structure Of The Il-10/Il-10R1 Complex Reveals A Shared Receptor Binding Site.
Immunity V. 15 35 2001
PubMed-ID: 11485736 | Reference-DOI: 10.1016/S1074-7613(01)00169-8
(for further references see the PDB file header)

Molecule 1 - INTERLEUKIN-10
	Chains	:	L
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	IL-10; CYTOKINE SYNTHESIS INHIBITORY FACTOR; CSIF

Molecule 2 - INTERLEUKIN-10 RECEPTOR ALPHA CHAIN
	Chains	:	R
	Engineered	:	YES
	Expression System	:	DROSOPHILA MELANOGASTER
	Expression System Cell Line	:	SCHNEIDER CELLS
	Expression System Common	:	FRUIT FLY
	Expression System Taxid	:	7227
	Fragment	:	EXTRACELLULAR DOMAIN, RESIDUES 22-235
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	IL-10R1; IL-10R-A

		1	2
Asymmetric Unit	:	L	R
Biological Unit 1 (2x)	:	L	R

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1J7V)

(no "Site" information available for 1J7V)

Asymmetric Unit

No.	Residues
1	L:12	-	L:108
2	L:62	-	L:114
3	R:35	-	R:54
4	R:181	-	R:202

(no "Cis Peptide Bond" information available for 1J7V)

Asymmetric Unit (11, 11)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_016294	L	61	V	I10R1_HUMAN	Polymorphism	4252250	R	L	40	V
02	UniProt	VAR_071663	W	69	R	I10R1_HUMAN	Disease (IBD28)	---	R	W	48	R
03	UniProt	VAR_063542	T	84	I	I10R1_HUMAN	Disease (IBD28)	137853580	R	T	63	I
04	UniProt	VAR_071664	Y	91	C	I10R1_HUMAN	Disease (IBD28)	---	R	Y	70	C
05	UniProt	VAR_071665	R	101	W	I10R1_HUMAN	Disease (IBD28)	368287711	R	R	80	W
06	UniProt	VAR_016295	V	113	I	I10R1_HUMAN	Polymorphism	4252303	R	V	92	I
07	UniProt	VAR_071666	R	117	H	I10R1_HUMAN	Disease (IBD28)	199989396	R	R	96	H
08	UniProt	VAR_063543	G	141	R	I10R1_HUMAN	Disease (IBD28)	137853579	R	G	120	R
09	UniProt	VAR_016296	S	159	G	I10R1_HUMAN	Polymorphism	3135932	R	S	138	G
10	UniProt	VAR_016297	R	212	Q	I10R1_HUMAN	Polymorphism	4252273	R	R	191	Q
11	UniProt	VAR_020004	I	224	V	I10R1_HUMAN	Polymorphism	2228055	R	I	203	V

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (11, 22)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_016294	L	61	V	I10R1_HUMAN	Polymorphism	4252250	R	L	40	V
02	UniProt	VAR_071663	W	69	R	I10R1_HUMAN	Disease (IBD28)	---	R	W	48	R
03	UniProt	VAR_063542	T	84	I	I10R1_HUMAN	Disease (IBD28)	137853580	R	T	63	I
04	UniProt	VAR_071664	Y	91	C	I10R1_HUMAN	Disease (IBD28)	---	R	Y	70	C
05	UniProt	VAR_071665	R	101	W	I10R1_HUMAN	Disease (IBD28)	368287711	R	R	80	W
06	UniProt	VAR_016295	V	113	I	I10R1_HUMAN	Polymorphism	4252303	R	V	92	I
07	UniProt	VAR_071666	R	117	H	I10R1_HUMAN	Disease (IBD28)	199989396	R	R	96	H
08	UniProt	VAR_063543	G	141	R	I10R1_HUMAN	Disease (IBD28)	137853579	R	G	120	R
09	UniProt	VAR_016296	S	159	G	I10R1_HUMAN	Polymorphism	3135932	R	S	138	G
10	UniProt	VAR_016297	R	212	Q	I10R1_HUMAN	Polymorphism	4252273	R	R	191	Q
11	UniProt	VAR_020004	I	224	V	I10R1_HUMAN	Polymorphism	2228055	R	I	203	V

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	INTERLEUKIN_10	PS00520	Interleukin-10 family signature.	IL10_HUMAN	75-95	1	L:57-77

Biological Unit 1 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	INTERLEUKIN_10	PS00520	Interleukin-10 family signature.	IL10_HUMAN	75-95	2	L:57-77

Asymmetric Unit (5, 5)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000227752	1a	ENSE00002150184	chr11:117857063-117857249	187	I10R1_HUMAN	1-23	23	1	R:2-2	1
1.1i	ENST00000227752	1i	ENSE00001053160	chr11:117859097-117859217	121	I10R1_HUMAN	23-63	41	1	R:2-42	41
1.2b	ENST00000227752	2b	ENSE00000795930	chr11:117860157-117860335	179	I10R1_HUMAN	63-123	61	1	R:42-102	61
1.3c	ENST00000227752	3c	ENSE00001053158	chr11:117863956-117864125	170	I10R1_HUMAN	123-179	57	1	R:102-158	57
1.4a	ENST00000227752	4a	ENSE00001053155	chr11:117864714-117864864	151	I10R1_HUMAN	180-230	51	1	R:159-206	48
1.5b	ENST00000227752	5b	ENSE00001053157	chr11:117866304-117866425	122	I10R1_HUMAN	230-270	41	0	-	-
1.6g	ENST00000227752	6g	ENSE00002200423	chr11:117869430-117872194	2765	I10R1_HUMAN	271-578	308	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain L from PDB  Type:PROTEIN  Length:150
 aligned with IL10_HUMAN | P22301 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:150
                                    38        48        58        68        78        88        98       108       118       128       138       148       158       168       178
           IL10_HUMAN    29 SCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN 178
               SCOP domains d1j7vl_ L: Interleukin-10 (cytokine synthesis inhibitory factor, CSIF)                                                                                 SCOP domains
               CATH domains 1j7vL00 L:11-160  [code=1.20.1250.10, no name defined]                                                                                                 CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......hhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh.....hhhhh.hhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----------------------------------------------INTERLEUKIN_10       ----------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1j7v L  11 SCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN 160
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160

Chain R from PDB  Type:PROTEIN  Length:205
 aligned with I10R1_HUMAN | Q13651 from UniProtKB/Swiss-Prot  Length:578

    Alignment length:205
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222     
          I10R1_HUMAN    23 GTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWNSISNCSQTLSYDLTAVTLDLYHSNGYRARVRAVDGSRHSNWTVTNTRFSVDEVTLTVGSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGNFTFTHKKVKHENFSLLTSGEVGEFCVQVKPSVASRSNKGMWSKEECISLT 227
               SCOP domains d1j7vr1 R:2-100 Interleukin-10 receptor 1, IL-10R1                                                 d1j7vr2 R:101-206 Interleukin-10 receptor 1, IL-10R1                                                       SCOP domains
               CATH domains 1j7vR01 R:2-103 Immunoglobulins                                                                       1j7vR02 R:104-206 Immunoglobulins                                                                       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeee..eeeeee..........eeeeeeee.....eeeeeeee...eee.hhhhh.......eeeeeeeee..ee...ee.....hhh.ee....eeeeee...eeeeeee...........hhhhhh...eeeeeeeee.......eeeee...eeeee.......eeeeeeeee.................. Sec.struct. author
                 SAPs(SNPs) --------------------------------------V-------R--------------I------C---------W-----------I---H-----------------------R-----------------G----------------------------------------------------Q-----------V--- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1---------------------------------------Exon 1.2b  PDB: R:42-102 UniProt: 63-123                     --------------------------------------------------------Exon 1.4a  PDB: R:159-206 UniProt: 180-230       Transcript 1 (1)
           Transcript 1 (2) Exon 1.1i  PDB: R:2-42 UniProt: 23-63    -----------------------------------------------------------Exon 1.3c  PDB: R:102-158 UniProt: 123-179               ------------------------------------------------ Transcript 1 (2)
                 1j7v R   2 GTELPSPPSVWFEAEFFHHILHWTPIPQQSESTCYEVALLRYGIESWNSISQCSQTLSYDLTAVTLDLYHSNGYRARVRAVDGSRHSQWTVTNTRFSVDEVTLTVGSVNLEIHNGFILGKIQLPRPKMAPAQDTYESIFSHFREYEIAIRKVPGQFTFTHKKVKHEQFSLLTSGEVGEFCVQVKPSVASRSNKGMWSKEECISLT 206
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Up-down Bundle (3216)

Topology: Growth Hormone; Chain: A; (136)

Homologous Superfamily: [code=1.20.1250.10, no name defined] (130)

Human (Homo sapiens) (110)

1j7vL00

L:11-160

Class: Mainly Beta (13760)

Architecture: Sandwich (5577)

Topology: Immunoglobulin-like (3897)

Homologous Superfamily: Immunoglobulins (2282)

Human (Homo sapiens) (912)

2a	1j7vR02	R:104-206
2b	1j7vR01	R:2-103

(no "Pfam Domain" information available for 1J7V)

Asymmetric Unit(hide GO term definitions)

Chain L (IL10_HUMAN | P22301)

molecular function
	GO:0005125	cytokine activity	Functions to control the survival, growth, differentiation and effector function of tissues and cells.
	GO:0008083	growth factor activity	The function that stimulates a cell to grow or proliferate. Most growth factors have other actions besides the induction of cell growth or proliferation.
	GO:0005141	interleukin-10 receptor binding	Interacting selectively and non-covalently with the interleukin-10 receptor.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0030183	B cell differentiation	The process in which a precursor cell type acquires the specialized features of a B cell. A B cell is a lymphocyte of B lineage with the phenotype CD19-positive and capable of B cell mediated immunity.
	GO:0042100	B cell proliferation	The expansion of a B cell population by cell division. Follows B cell activation.
	GO:0007568	aging	A developmental process that is a deterioration and loss of function over time. Aging includes loss of functions such as resistance to disease, homeostasis, and fertility, as well as wear and tear. Aging includes cellular senescence, but is more inclusive. May precede death and may succeed developmental maturation (GO:0021700).
	GO:0060670	branching involved in labyrinthine layer morphogenesis	The process in which the branches of the fetal placental villi are generated and organized. The villous part of the placenta is called the labyrinth layer.
	GO:0007267	cell-cell signaling	Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
	GO:0071392	cellular response to estradiol stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of stimulus by estradiol, a C18 steroid hormone hydroxylated at C3 and C17 that acts as a potent estrogen.
	GO:0035729	cellular response to hepatocyte growth factor stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hepatocyte growth factor stimulus.
	GO:0071222	cellular response to lipopolysaccharide	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
	GO:0007253	cytoplasmic sequestering of NF-kappaB	The selective interaction of the transcription factor NF-kappaB with specific molecules in the cytoplasm, thereby inhibiting its translocation into the nucleus.
	GO:0042742	defense response to bacterium	Reactions triggered in response to the presence of a bacterium that act to protect the cell or organism.
	GO:0042832	defense response to protozoan	Reactions triggered in response to the presence of a protozoan that act to protect the cell or organism.
	GO:0030097	hemopoiesis	The process whose specific outcome is the progression of the myeloid and lymphoid derived organ/tissue systems of the blood and other parts of the body over time, from formation to the mature structure. The site of hemopoiesis is variable during development, but occurs primarily in bone marrow or kidney in many adult vertebrates.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0006954	inflammatory response	The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
	GO:0030595	leukocyte chemotaxis	The movement of a leukocyte in response to an external stimulus.
	GO:0030889	negative regulation of B cell proliferation	Any process that stops, prevents or reduces the rate or extent of B cell proliferation.
	GO:0045347	negative regulation of MHC class II biosynthetic process	Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of MHC class II.
	GO:0042130	negative regulation of T cell proliferation	Any process that stops, prevents or reduces the rate or extent of T cell proliferation.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0071650	negative regulation of chemokine (C-C motif) ligand 5 production	Any process that stops, prevents, or reduces the frequency, rate, or extent of production of chemokine (C-C motif) ligand 5.
	GO:0002875	negative regulation of chronic inflammatory response to antigenic stimulus	Any process that stops, prevents, or reduces the frequency, rate, or extent of a chronic inflammatory response to an antigenic stimulus.
	GO:0060302	negative regulation of cytokine activity	Any process that decreases the rate, frequency or extent of the activity of a molecule that controls the survival, growth, differentiation and effector function of tissues and cells.
	GO:0001818	negative regulation of cytokine production	Any process that stops, prevents, or reduces the rate of production of a cytokine.
	GO:0002740	negative regulation of cytokine secretion involved in immune response	Any process that stops, prevents, or reduces the frequency, rate, or extent of cytokine secretion contributing to an immune response.
	GO:2000352	negative regulation of endothelial cell apoptotic process	Any process that stops, prevents or reduces the frequency, rate or extent of endothelial cell apoptotic process.
	GO:0044130	negative regulation of growth of symbiont in host	Any process in which the symbiont stops, prevents or reduces its increase in size or mass within the cells or tissues of the host organism. The host is defined as the larger of the organisms involved in the symbiotic interaction.
	GO:0050728	negative regulation of inflammatory response	Any process that stops, prevents, or reduces the frequency, rate or extent of the inflammatory response.
	GO:0045355	negative regulation of interferon-alpha biosynthetic process	Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of interferon-alpha.
	GO:0032689	negative regulation of interferon-gamma production	Any process that stops, prevents, or reduces the frequency, rate, or extent of interferon-gamma production. Interferon-gamma is also known as type II interferon.
	GO:0032692	negative regulation of interleukin-1 production	Any process that stops, prevents, or reduces the frequency, rate, or extent of interleukin-1 production.
	GO:0032695	negative regulation of interleukin-12 production	Any process that stops, prevents, or reduces the frequency, rate, or extent of interleukin-12 production.
	GO:0032701	negative regulation of interleukin-18 production	Any process that stops, prevents, or reduces the frequency, rate, or extent of interleukin-18 production.
	GO:0032715	negative regulation of interleukin-6 production	Any process that stops, prevents, or reduces the frequency, rate, or extent of interleukin-6 production.
	GO:0032717	negative regulation of interleukin-8 production	Any process that stops, prevents, or reduces the frequency, rate, or extent of interleukin-8 production.
	GO:0051045	negative regulation of membrane protein ectodomain proteolysis	Any process that stops, prevents, or reduces the frequency, rate or extent of membrane protein ectodomain proteolysis.
	GO:0030886	negative regulation of myeloid dendritic cell activation	Any process that stops, prevents, or reduces the frequency, rate or extent of myeloid dendritic cell activation.
	GO:0045019	negative regulation of nitric oxide biosynthetic process	Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of nitric oxide.
	GO:0042536	negative regulation of tumor necrosis factor biosynthetic process	Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of tumor necrosis factor, an inflammatory cytokine produced by macrophages/monocytes during acute inflammation and which is responsible for a diverse range of signaling events within cells, leading to necrosis or apoptosis.
	GO:0032720	negative regulation of tumor necrosis factor production	Any process that stops, prevents, or reduces the frequency, rate, or extent of tumor necrosis factor production.
	GO:0002904	positive regulation of B cell apoptotic process	Any process that activates or increases the frequency, rate, or extent of B cell apoptotic process.
	GO:0046427	positive regulation of JAK-STAT cascade	Any process that activates or increases the frequency, rate or extent of the JAK-STAT signaling pathway activity.
	GO:0045348	positive regulation of MHC class II biosynthetic process	Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of MHC class II.
	GO:0050715	positive regulation of cytokine secretion	Any process that activates or increases the frequency, rate or extent of the regulated release of cytokines from a cell.
	GO:0051091	positive regulation of sequence-specific DNA binding transcription factor activity	Any process that activates or increases the frequency, rate or extent of activity of a transcription factor, any factor involved in the initiation or regulation of transcription.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0045893	positive regulation of transcription, DNA-templated	Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0032800	receptor biosynthetic process	The chemical reactions and pathways resulting in the formation of a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
	GO:1903659	regulation of complement-dependent cytotoxicity	Any process that modulates the frequency, rate or extent of complement-dependent cytotoxicity.
	GO:0010468	regulation of gene expression	Any process that modulates the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0045191	regulation of isotype switching	Any process that modulates the frequency, rate or extent of isotype switching.
	GO:0051930	regulation of sensory perception of pain	Any process that modulates the frequency, rate or extent of the sensory perception of pain, the series of events required for an organism to receive a painful stimulus, convert it to a molecular signal, and recognize and characterize the signal.
	GO:0014823	response to activity	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an activity stimulus.
	GO:0034465	response to carbon monoxide	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a carbon monoxide (CO) stimulus.
	GO:0042493	response to drug	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0051384	response to glucocorticoid	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucocorticoid stimulus. Glucocorticoids are hormonal C21 corticosteroids synthesized from cholesterol with the ability to bind with the cortisol receptor and trigger similar effects. Glucocorticoids act primarily on carbohydrate and protein metabolism, and have anti-inflammatory effects.
	GO:0014854	response to inactivity	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an inactivity stimulus.
	GO:0032868	response to insulin	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an insulin stimulus. Insulin is a polypeptide hormone produced by the islets of Langerhans of the pancreas in mammals, and by the homologous organs of other organisms.
	GO:0032496	response to lipopolysaccharide	Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
	GO:0002237	response to molecule of bacterial origin	Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus by molecules of bacterial origin such as peptides derived from bacterial flagellin.
	GO:0010033	response to organic substance	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic substance stimulus.
	GO:0042092	type 2 immune response	An immune response which is associated with resistance to extracellular organisms such as helminths and pathological conditions such as allergy, which is orchestrated by the production of particular cytokines, most notably IL-4, IL-5, IL-10, and IL-13, by any of a variety of cell types including T-helper 2 cells, eosinophils, basophils, mast cells, and nuocytes, resulting in enhanced production of certain antibody isotypes and other effects.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

Chain R (I10R1_HUMAN | Q13651)

molecular function
	GO:0019969	interleukin-10 binding	Interacting selectively and non-covalently with interleukin-10.
	GO:0004920	interleukin-10 receptor activity	Combining with interleukin-10 and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004872	receptor activity	Combining with an extracellular or intracellular messenger to initiate a change in cell activity.
	GO:0004871	signal transducer activity	Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
biological process
	GO:0019221	cytokine-mediated signaling pathway	A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0032496	response to lipopolysaccharide	Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1j7v)

	Sites
(no "Sites" information available for 1j7v)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1j7v)

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1j7v
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	I10R1_HUMAN \| Q13651
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	IL10_HUMAN \| P22301
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	613148
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	I10R1_HUMAN \| Q13651
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	IL10_HUMAN \| P22301
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	I10R1_HUMAN \| Q13651	:	1lqs 1y6k 1y6m 1y6n 5ixi
	IL10_HUMAN \| P22301	:	1ilk 1inr 1lk3 1y6k 2h24 2ilk

(no "Related Entries Specified in the PDB File" available for 1J7V)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (4, 4)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (11, 11)

PROSITE Motifs (1, 1)

Exons (5, 5)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 3)

CATH Domains (2, 3)

Pfam Domains (0, 0)

Gene Ontology (76, 78)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File