1ITU - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   HUMAN RENAL DIPEPTIDASE COMPLEXED WITH CILASTATIN

Authors :   Y. Nitanai, Y. Satow, H. Adachi, M. Tsujimoto

Date :   03 Feb 02 (Deposition) - 28 Aug 02 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.00

Chains :   Asym./Biol. Unit : A,B

Keywords :   Dipeptidase, Glycoprotein, Membrane-Bound, Zinc Protease Beta- Lactamase, Cilastatin, Complex (Hydrolase-Inhibitor), Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Nitanai, Y. Satow, H. Adachi, M. Tsujimoto
Crystal Structure Of Human Renal Dipeptidase Involved In Beta-Lactam Hydrolysis
J. Mol. Biol. V. 321 177 2002
PubMed-ID: 12144777 | Reference-DOI: 10.1016/S0022-2836(02)00632-0
(for further references see the PDB file header)

Molecule 1 - RENAL DIPEPTIDASE
	Chains	:	A, B
	EC Number	:	3.4.13.19
	Engineered	:	YES
	Expression System	:	PICHIA PASTORIS
	Expression System Plasmid	:	PHILD2
	Expression System Strain	:	GS115
	Expression System Taxid	:	4922
	Expression System Vector Type	:	PLASMID
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	MICROSOMAL DIPEPTIDASE
	Tissue	:	RENAL CORTEX

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (3, 10)

No.	Name	Count	Type	Full Name
1	CIL	2	Ligand/Ion	CILASTATIN
2	NAG	4	Ligand/Ion	N-ACETYL-D-GLUCOSAMINE
3	ZN	4	Ligand/Ion	ZINC ION

Asymmetric Unit (10, 10)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	ASN A:41 , THR A:43 , MET A:95 , HOH A:1290 , HOH A:1343	BINDING SITE FOR RESIDUE NAG A 461
02	AC2	SOFTWARE	GLU B:38 , ASN B:41 , THR B:43 , HOH B:1515	BINDING SITE FOR RESIDUE NAG B 462
03	AC3	SOFTWARE	ASN A:316 , HOH B:1107	BINDING SITE FOR RESIDUE NAG A 463
04	AC4	SOFTWARE	PHE A:2 , GLU A:6 , ASN B:316 , THR B:318 , HOH B:1489 , HOH B:1601	BINDING SITE FOR RESIDUE NAG B 464
05	AC5	SOFTWARE	HIS A:20 , ASP A:22 , GLU A:125 , ZN A:402 , HOH A:421 , CIL A:451	BINDING SITE FOR RESIDUE ZN A 401
06	AC6	SOFTWARE	GLU A:125 , HIS A:198 , HIS A:219 , ZN A:401 , HOH A:421 , CIL A:451	BINDING SITE FOR RESIDUE ZN A 402
07	AC7	SOFTWARE	HIS B:20 , ASP B:22 , GLU B:125 , ZN B:412 , HOH B:422 , CIL B:452	BINDING SITE FOR RESIDUE ZN B 411
08	AC8	SOFTWARE	GLU B:125 , HIS B:198 , HIS B:219 , ZN B:411 , HOH B:422 , CIL B:452	BINDING SITE FOR RESIDUE ZN B 412
09	AC9	SOFTWARE	ASP A:22 , TYR A:68 , HIS A:152 , HIS A:198 , HIS A:219 , ARG A:230 , TYR A:252 , TYR A:255 , ASP A:288 , GLY A:291 , PRO A:293 , ZN A:401 , ZN A:402 , HOH A:421	BINDING SITE FOR RESIDUE CIL A 451
10	BC1	SOFTWARE	ASP B:22 , TYR B:68 , HIS B:152 , HIS B:198 , HIS B:219 , ARG B:230 , TYR B:255 , ASP B:288 , GLY B:291 , VAL B:292 , ZN B:411 , ZN B:412 , HOH B:422	BINDING SITE FOR RESIDUE CIL B 452

Asymmetric/Biological Unit

No.	Residues
1	A:71	-	A:154
2	A:226	-	A:258
3	A:361	-	B:361
4	B:71	-	B:154
5	B:226	-	B:258

(no "Cis Peptide Bond" information available for 1ITU)

Asymmetric/Biological Unit (4, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_036496	R	246	H	DPEP1_HUMAN	Unclassified	---	A/B	R	230	H
2	CancerSNP	VAR_DPEP1_HUMAN_CCDS10982_1_01 *	R	246	H	DPEP1_HUMAN	Disease (Colorectal cancer)	---	A/B	R	230	H
3	UniProt	VAR_061375	E	351	K	DPEP1_HUMAN	Polymorphism	1126464	A/B	E	335	K
4	UniProt	VAR_061376	E	351	Q	DPEP1_HUMAN	Polymorphism	1126464	A/B	E	335	Q
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RENAL_DIPEPTIDASE_2	PS51365	Renal dipeptidase family profile.	DPEP1_HUMAN	17-385	2	A:1-369 B:1-369
2	RENAL_DIPEPTIDASE_1	PS00869	Renal dipeptidase active site.	DPEP1_HUMAN	140-162	2	A:124-146 B:124-146

Asymmetric/Biological Unit (10, 20)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2	ENST00000393092	2	ENSE00001514166	chr16:89687000-89687184	185	DPEP1_HUMAN	-	0	0	-	-
1.3b	ENST00000393092	3b	ENSE00000946266	chr16:89696713-89696922	210	DPEP1_HUMAN	1-35	35	2	A:1-19 B:1-19	19 19
1.4	ENST00000393092	4	ENSE00001312895	chr16:89702316-89702448	133	DPEP1_HUMAN	35-79	45	2	A:19-63 B:19-63	45 45
1.5	ENST00000393092	5	ENSE00001290840	chr16:89702672-89702804	133	DPEP1_HUMAN	80-124	45	2	A:64-108 B:64-108	45 45
1.6	ENST00000393092	6	ENSE00001314206	chr16:89702941-89703091	151	DPEP1_HUMAN	124-174	51	2	A:108-158 B:108-158	51 51
1.7	ENST00000393092	7	ENSE00001292209	chr16:89703274-89703343	70	DPEP1_HUMAN	174-197	24	2	A:158-181 B:158-181	24 24
1.8	ENST00000393092	8	ENSE00001325387	chr16:89703612-89703788	177	DPEP1_HUMAN	198-256	59	2	A:182-240 B:182-240	59 59
1.9	ENST00000393092	9	ENSE00001292673	chr16:89703876-89703960	85	DPEP1_HUMAN	257-285	29	2	A:241-269 B:241-269	29 29
1.10	ENST00000393092	10	ENSE00001305962	chr16:89704040-89704115	76	DPEP1_HUMAN	285-310	26	2	A:269-294 B:269-294	26 26
1.11	ENST00000393092	11	ENSE00001314382	chr16:89704244-89704379	136	DPEP1_HUMAN	310-355	46	2	A:294-339 B:294-339	46 46
1.12a	ENST00000393092	12a	ENSE00001307235	chr16:89704460-89704838	379	DPEP1_HUMAN	356-411	56	2	A:340-369 B:340-369	30 30

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:369
 aligned with DPEP1_HUMAN | P16444 from UniProtKB/Swiss-Prot  Length:411

    Alignment length:369
                                    26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376         
          DPEP1_HUMAN    17 DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS 385
               SCOP domains d1itua_ A: Renal dipeptidase                                                                                                                                                                                                                                                                                                                                                      SCOP domains
               CATH domains 1ituA00 A:1-369 Metal-dependent hydrolases                                                                                                                                                                                                                                                                                                                                        CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhh...eeeeeehhhhhhhhhhh....hhhhh.........hhhhhhhh.eeeeeeee..hhhhh..hhhhhhhhhhhhhhhhhhhh...eee..hhhhhhhhhhhh.eeeeeeee.hhhhh.hhhhhhhhhhh.eeeee...........hhhhh...........hhhhhhhhhhhhhhh.eee....hhhhhhhhhhhh....ee...............hhhhhhhhhhhh.eeee..hhhhhh.....hhhhhhhhhhhhhhhhh...eee..................hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh...........hhhhh............ Sec.struct. author
             SAPs(SNPs) (1) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------H--------------------------------------------------------------------------------------------------------K---------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------H--------------------------------------------------------------------------------------------------------Q---------------------------------- SAPs(SNPs) (2)
                PROSITE (1) RENAL_DIPEPTIDASE_2  PDB: A:1-369 UniProt: 17-385                                                                                                                                                                                                                                                                                                                                 PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------RENAL_DIPEPTIDASE_1    ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.3b          --------------------------------------------Exon 1.5  PDB: A:64-108 UniProt: 80-124      -------------------------------------------------Exon 1.7  PDB: A:158-181Exon 1.8  PDB: A:182-240 UniProt: 198-256                  ----------------------------Exon 1.10  PDB: A:269-294 ---------------------------------------------Exon 1.12a  PDB: A:340-369     Transcript 1 (1)
           Transcript 1 (2) ------------------Exon 1.4  PDB: A:19-63 UniProt: 35-79        --------------------------------------------Exon 1.6  PDB: A:108-158 UniProt: 124-174          ----------------------------------------------------------------------------------Exon 1.9  PDB: A:241-269     ------------------------Exon 1.11  PDB: A:294-339 UniProt: 310-355    ------------------------------ Transcript 1 (2)
                 1itu A   1 DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS 369
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360

Chain B from PDB  Type:PROTEIN  Length:369
 aligned with DPEP1_HUMAN | P16444 from UniProtKB/Swiss-Prot  Length:411

    Alignment length:369
                                    26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376         
          DPEP1_HUMAN    17 DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS 385
               SCOP domains d1itub_ B: Renal dipeptidase                                                                                                                                                                                                                                                                                                                                                      SCOP domains
               CATH domains 1ituB00 B:1-369 Metal-dependent hydrolases                                                                                                                                                                                                                                                                                                                                        CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhh.eeeeeehhhhhhhhhhh....hhhhh.........hhhhhhhh.eeeeeeee..hhhhh..hhhhhhhhhhhhhhhhhhhh...eee..hhhhhhhhhhhh.eeeeeeee.hhhh..hhhhhhhhhhh.eeeee...........hhhhh...........hhhhhhhhhhhhhhh.eee....hhhhhhhhhhhh....ee...............hhhhhhhhhhhh.eeee..hhhhhh.....hhhhhhhhhhhhhhhhhhh.eee...............hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh............hhhhh............ Sec.struct. author
             SAPs(SNPs) (1) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------H--------------------------------------------------------------------------------------------------------K---------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------H--------------------------------------------------------------------------------------------------------Q---------------------------------- SAPs(SNPs) (2)
                PROSITE (1) RENAL_DIPEPTIDASE_2  PDB: B:1-369 UniProt: 17-385                                                                                                                                                                                                                                                                                                                                 PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------RENAL_DIPEPTIDASE_1    ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.3b          --------------------------------------------Exon 1.5  PDB: B:64-108 UniProt: 80-124      -------------------------------------------------Exon 1.7  PDB: B:158-181Exon 1.8  PDB: B:182-240 UniProt: 198-256                  ----------------------------Exon 1.10  PDB: B:269-294 ---------------------------------------------Exon 1.12a  PDB: B:340-369     Transcript 1 (1)
           Transcript 1 (2) ------------------Exon 1.4  PDB: B:19-63 UniProt: 35-79        --------------------------------------------Exon 1.6  PDB: B:108-158 UniProt: 124-174          ----------------------------------------------------------------------------------Exon 1.9  PDB: B:241-269     ------------------------Exon 1.11  PDB: B:294-339 UniProt: 310-355    ------------------------------ Transcript 1 (2)
                 1itu B   1 DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS 369
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: TIM beta/alpha-barrel (3956)

Superfamily: Metallo-dependent hydrolases (273)

Family: Renal dipeptidase (2)

Protein domain: Renal dipeptidase (2)

Human (Homo sapiens) [TaxId: 9606] (2)

1a	d1itua_	A:
1b	d1itub_	B:

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: Alpha-Beta Barrel (2994)

Topology: TIM Barrel (2806)

Homologous Superfamily: Metal-dependent hydrolases (190)

Human (Homo sapiens) (5)

1a	1ituA00	A:1-369
1b	1ituB00	B:1-369

(no "Pfam Domain" information available for 1ITU)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (DPEP1_HUMAN | P16444)

molecular function
	GO:0034235	GPI anchor binding	Interacting selectively and non-covalently with any glycosylphosphatidylinositol anchor. GPI anchors serve to attach membrane proteins to the lipid bilayer of cell membranes.
	GO:0043027	cysteine-type endopeptidase inhibitor activity involved in apoptotic process	Stops, prevents or reduces the activity of a cysteine-type endopeptidase involved in the apoptotic process.
	GO:0016805	dipeptidase activity	Catalysis of the hydrolysis of a dipeptide.
	GO:0008239	dipeptidyl-peptidase activity	Catalysis of the hydrolysis of N-terminal dipeptides from a polypeptide chain.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0070573	metallodipeptidase activity	Catalysis of the hydrolysis of a dipeptide by a mechanism in which water acts as a nucleophile, one or two metal ions hold the water molecule in place, and charged amino acid side chains are ligands for the metal ions.
	GO:0008235	metalloexopeptidase activity	Catalysis of the hydrolysis of a peptide bond not more than three residues from the N- or C-terminus of a polypeptide chain by a mechanism in which water acts as a nucleophile, one or two metal ions hold the water molecule in place, and charged amino acid side chains are ligands for the metal ions.
	GO:0008237	metallopeptidase activity	Catalysis of the hydrolysis of peptide bonds by a mechanism in which water acts as a nucleophile, one or two metal ions hold the water molecule in place, and charged amino acid side chains are ligands for the metal ions.
	GO:0072341	modified amino acid binding	Interacting selectively and non-covalently with a modified amino acid.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0016999	antibiotic metabolic process	The chemical reactions and pathways involving an antibiotic, a substance produced by or derived from certain fungi, bacteria, and other organisms, that can destroy or inhibit the growth of other microorganisms.
	GO:0072340	cellular lactam catabolic process	The chemical reactions and pathways resulting in the breakdown of lactams, any cyclic amides of amino carboxylic acids, having a 1-azacycloalkan-2-one structure, or analogues having unsaturation or heteroatoms replacing one or more carbon atoms of the ring.
	GO:0071277	cellular response to calcium ion	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a calcium ion stimulus.
	GO:0035690	cellular response to drug	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0071732	cellular response to nitric oxide	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a nitric oxide stimulus.
	GO:0006749	glutathione metabolic process	The chemical reactions and pathways involving glutathione, the tripeptide glutamylcysteinylglycine, which acts as a coenzyme for some enzymes and as an antioxidant in the protection of sulfhydryl groups in enzymes and other proteins; it has a specific role in the reduction of hydrogen peroxide (H2O2) and oxidized ascorbate, and it participates in the gamma-glutamyl cycle.
	GO:0050667	homocysteine metabolic process	The chemical reactions and pathways involving homocysteine, the amino acid alpha-amino-gamma-mercaptobutanoic acid. Homocysteine is an important intermediate in the metabolic reactions of its S-methyl derivative, methionine.
	GO:0006691	leukotriene metabolic process	The chemical reactions and pathways involving leukotriene, a pharmacologically active substance derived from a polyunsaturated fatty acid, such as arachidonic acid.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0030336	negative regulation of cell migration	Any process that stops, prevents, or reduces the frequency, rate or extent of cell migration.
	GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of a cysteine-type endopeptidase activity involved in the apoptotic process.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
	GO:0006805	xenobiotic metabolic process	The chemical reactions and pathways involving a xenobiotic compound, a compound foreign to living organisms. Used of chemical compounds, e.g. a xenobiotic chemical, such as a pesticide.
cellular component
	GO:0031225	anchored component of membrane	The component of a membrane consisting of the gene products that are tethered to the membrane only by a covalently attached anchor, such as a lipid group that is embedded in the membrane. Gene products with peptide sequences that are embedded in the membrane are excluded from this grouping.
	GO:0045177	apical part of cell	The region of a polarized cell that forms a tip or is distal to a base. For example, in a polarized epithelial cell, the apical region has an exposed surface and lies opposite to the basal lamina that separates the epithelium from other tissue.
	GO:0016324	apical plasma membrane	The region of the plasma membrane located at the apical end of the cell.
	GO:0042995	cell projection	A prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0031528	microvillus membrane	The portion of the plasma membrane surrounding a microvillus.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CIL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NAG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1itu)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1itu
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	DPEP1_HUMAN \| P16444
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.4.13.19
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	DPEP1_HUMAN \| P16444
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	DPEP1_HUMAN \| P16444	:	1itq

1itq	1ITQ CONTAINS THE SAME PROTEIN WITHOUT A LIGAND.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 10)

Sites (10, 10)

SS Bonds (5, 5)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (4, 8)

PROSITE Motifs (2, 4)

Exons (10, 20)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (35, 35)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File