|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1IMT) |
Sites (0, 0)| (no "Site" information available for 1IMT) |
SS Bonds (5, 5)
NMR Structure
|
||||||||||||||||||||||||
Cis Peptide Bonds (1, 39)
NMR Structure
|
||||||||||
SAPs(SNPs)/Variants (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1IMT) |
Exons (0, 0)| (no "Exon" information available for 1IMT) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:80 aligned with MIT1_DENPO | P25687 from UniProtKB/Swiss-Prot Length:81 Alignment length:80 10 20 30 40 50 60 70 80 MIT1_DENPO 1 AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK 80 SCOP domains d1imta1 A:1-36 Intestinal toxin 1 d1imta2 A:37-80 Intestinal toxin 1 SCOP domains CATH domains 1imtA00 A:1-80 Lipase, subunit A CATH domains Pfam domains -------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -----------------------------------------------------------------------Q-------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------- Transcript 1imt A 1 AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK 80 10 20 30 40 50 60 70 80
|
||||||||||||||||||||
SCOP Domains (1, 2)| NMR Structure |
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1IMT) |
Gene Ontology (1, 1)|
NMR Structure(hide GO term definitions) Chain A (MIT1_DENPO | P25687)
|
||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|