|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
NMR Structure (1, 2)
|
NMR Structure (2, 2)
|
(no "SS Bond" information available for 1IML) |
NMR Structure
|
(no "SAP(SNP)/Variant" information available for 1IML) |
NMR Structure (2, 2)
|
NMR Structure (4, 4)
|
NMR StructureChain A from PDB Type:PROTEIN Length:76 aligned with CRIP1_MOUSE | P63254 from UniProtKB/Swiss-Prot Length:77 Alignment length:76 11 21 31 41 51 61 71 CRIP1_MOUSE 2 PKCPKCDKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYSAMFGPKGFGRGGAESHTFK 77 SCOP domains d1imla1 A:1-28 d1imla2 A:29-76 SCOP domains CATH domains 1imlA00 A:1-76 Cysteine Rich Protein CATH domains Pfam domains ---------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------- SAPs(SNPs) PROSITE (2) LIM_DOMAIN_2 PDB: A:1-62 UniProt: 2-63 -------------- PROSITE (2) PROSITE (3) --LIM_DOMAIN_1 PDB: A:3-37 --------------------------------------- PROSITE (3) Transcript ---------------------------------------------------------------------------- Transcript 1iml A 1 PKCPKCDKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYSAMFGPKGFGRGGAESHTFK 76 10 20 30 40 50 60 70 Chain A from PDB Type:PROTEIN Length:76 aligned with CRIP1_RAT | P63255 from UniProtKB/Swiss-Prot Length:77 Alignment length:76 11 21 31 41 51 61 71 CRIP1_RAT 2 PKCPKCDKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYSAMFGPKGFGRGGAESHTFK 77 SCOP domains d1imla1 A:1-28 d1imla2 A:29-76 SCOP domains CATH domains 1imlA00 A:1-76 Cysteine Rich Protein CATH domains Pfam domains ---------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) LIM_DOMAIN_2 PDB: A:1-62 UniProt: 2-63 -------------- PROSITE (1) PROSITE (2) ---------------------------------------------------------------------------- PROSITE (2) PROSITE (3) ---------------------------------------------------------------------------- PROSITE (3) PROSITE (4) --LIM_DOMAIN_1 PDB: A:3-37 --------------------------------------- PROSITE (4) Transcript 1 (1) Exon 1.2 -------------------------------Exon 1.4 ------------ Transcript 1 (1) Transcript 1 (2) ------------Exon 1.3 PDB: A:13-44 -------------------Exon 1.5 Transcript 1 (2) 1iml A 1 PKCPKCDKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYSAMFGPKGFGRGGAESHTFK 76 10 20 30 40 50 60 70
|
NMR Structure
|
NMR Structure |
(no "Pfam Domain" information available for 1IML) |
NMR Structure(hide GO term definitions) Chain A (CRIP1_MOUSE | P63254)
Chain A (CRIP1_RAT | P63255)
|
|
|
|
|
|
|