Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - model 1, sites
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - model 1, sites
NMR Structure - model 1, sites  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  CYSTEINE RICH INTESTINAL PROTEIN, NMR, 48 STRUCTURES
 
Authors :  G. C. Perez-Alvarado, J. L. Kosa, H. A. Louis, M. C. Beckerle, D. R. Winge, M. F. Summers
Date :  23 Dec 95  (Deposition) - 11 Jul 96  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (48x)
Keywords :  Metal-Binding Protein, Lim Domain Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  G. C. Perez-Alvarado, J. L. Kosa, H. A. Louis, M. C. Beckerle, D. R. Winge, M. F. Summers
Structure Of The Cysteine-Rich Intestinal Protein, Crip.
J. Mol. Biol. V. 257 153 1996
PubMed-ID: 8632452  |  Reference-DOI: 10.1006/JMBI.1996.0153
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CYSTEINE RICH INTESTINAL PROTEIN
    Cell: SMOOTH MUSCLE CELLS
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Gene: CRIP
    Expression System Plasmid: PET-3A NOVAGEN
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Gene: CRIP
    Organ: SMALL INTESTINE
    Organism Common: BLACK RAT
    Organism Scientific: RATTUS RATTUS
    Organism Taxid: 10117
    Synonym: CRIP
    Tissue: SMOOTH MUSCLE

 Structural Features

(-) Chains, Units

  
NMR Structure (48x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

NMR Structure (1, 2)
No.NameCountTypeFull Name
1ZN2Ligand/IonZINC ION

(-) Sites  (2, 2)

NMR Structure (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARECYS A:3 , CYS A:6 , HIS A:24 , CYS A:27BINDING SITE FOR RESIDUE ZN A 77
2AC2SOFTWARECYS A:30 , CYS A:33 , CYS A:51 , CYS A:55BINDING SITE FOR RESIDUE ZN A 78

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1IML)

(-) Cis Peptide Bonds  (1, 48)

NMR Structure
No.ModelResidues
11, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48His A:53 -Pro A:54

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1IML)

(-) PROSITE Motifs  (2, 2)

NMR Structure (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1LIM_DOMAIN_2PS50023 LIM domain profile.CRIP1_MOUSE2-63  1A:1-62
CRIP1_RAT2-63  1A:1-62
2LIM_DOMAIN_1PS00478 LIM zinc-binding domain signature.CRIP1_MOUSE4-38  1A:3-37
CRIP1_RAT4-38  1A:3-37

(-) Exons   (4, 4)

NMR Structure (4, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENSRNOT000000068351ENSRNOE00000452026chr6:138156366-138156498133CRIP1_RAT-00--
1.2ENSRNOT000000068352ENSRNOE00000261255chr6:138159185-13815925672CRIP1_RAT1-14141A:1-1313
1.3ENSRNOT000000068353ENSRNOE00000048861chr6:138160362-13816045695CRIP1_RAT14-45321A:13-4432
1.4ENSRNOT000000068354ENSRNOE00000048910chr6:138160533-13816059058CRIP1_RAT46-65201A:45-6420
1.5ENSRNOT000000068355ENSRNOE00000048944chr6:138160699-13816074547CRIP1_RAT65-77131A:64-7613
1.6ENSRNOT000000068356ENSRNOE00000433539chr6:138160851-138161127277CRIP1_RAT-00--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:76
 aligned with CRIP1_MOUSE | P63254 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:76
                                    11        21        31        41        51        61        71      
           CRIP1_MOUSE    2 PKCPKCDKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYSAMFGPKGFGRGGAESHTFK 77
               SCOP domains d1imla1 A:1-28              d1imla2 A:29-76                                  SCOP domains
               CATH domains 1imlA00 A:1-76 Cysteine Rich Protein                                         CATH domains
               Pfam domains ---------------------------------------------------------------------------- Pfam domains
     Sec.struct. author (1) .ee....eeee...eeee..eeee...eee....eeee...eeee..---hhhhhhhhh................. Sec.struct. author (1)
     Sec.struct. author (2) -----------------------------------------------eeee------------------------- Sec.struct. author (2)
                 SAPs(SNPs) ---------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) LIM_DOMAIN_2  PDB: A:1-62 UniProt: 2-63                       -------------- PROSITE (2)
                PROSITE (3) --LIM_DOMAIN_1  PDB: A:3-37          --------------------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------- Transcript
                  1iml A  1 PKCPKCDKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYSAMFGPKGFGRGGAESHTFK 76
                                    10        20        30        40        50        60        70      


Chain A from PDB  Type:PROTEIN  Length:76
 aligned with CRIP1_RAT | P63255 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:76
                                    11        21        31        41        51        61        71      
             CRIP1_RAT    2 PKCPKCDKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYSAMFGPKGFGRGGAESHTFK 77
               SCOP domains d1imla1 A:1-28              d1imla2 A:29-76                                  SCOP domains
               CATH domains 1imlA00 A:1-76 Cysteine Rich Protein                                         CATH domains
               Pfam domains ---------------------------------------------------------------------------- Pfam domains
     Sec.struct. author (1) .ee....eeee...eeee..eeee...eee....eeee...eeee..---hhhhhhhhh................. Sec.struct. author (1)
     Sec.struct. author (2) -----------------------------------------------eeee------------------------- Sec.struct. author (2)
                 SAPs(SNPs) ---------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) LIM_DOMAIN_2  PDB: A:1-62 UniProt: 2-63                       -------------- PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --LIM_DOMAIN_1  PDB: A:3-37          --------------------------------------- PROSITE (4)
           Transcript 1 (1) Exon 1.2     -------------------------------Exon 1.4            ------------ Transcript 1 (1)
           Transcript 1 (2) ------------Exon 1.3  PDB: A:13-44          -------------------Exon 1.5      Transcript 1 (2)
                  1iml A  1 PKCPKCDKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYSAMFGPKGFGRGGAESHTFK 76
                                    10        20        30        40        50        60        70
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

NMR Structure
(-)
Class: Small proteins (3458)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1IML)

(-) Gene Ontology  (10, 20)

NMR Structure(hide GO term definitions)
Chain A   (CRIP1_MOUSE | P63254)
molecular function
    GO:0003680    AT DNA binding    Interacting selectively and non-covalently with oligo(A) and oligo(T) tracts of DNA (AT DNA).
    GO:0008301    DNA binding, bending    The activity of binding selectively and non-covalently to and distorting the original structure of DNA, typically a straight helix, into a bend, or increasing the bend if the original structure was intrinsically bent due to its sequence.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0042277    peptide binding    Interacting selectively and non-covalently with peptides, any of a group of organic compounds comprising two or more amino acids linked by peptide bonds.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0071493    cellular response to UV-B    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a UV-B radiation stimulus. UV-B radiation (UV-B light) spans the wavelengths 280 to 315 nm.
    GO:0071236    cellular response to antibiotic    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an antibiotic stimulus. An antibiotic is a chemical substance produced by a microorganism which has the capacity to inhibit the growth of or to kill other microorganisms.
    GO:0008630    intrinsic apoptotic signaling pathway in response to DNA damage    A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the detection of DNA damage, and ends when the execution phase of apoptosis is triggered.
    GO:0010043    response to zinc ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a zinc ion stimulus.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Chain A   (CRIP1_RAT | P63255)
molecular function
    GO:0003680    AT DNA binding    Interacting selectively and non-covalently with oligo(A) and oligo(T) tracts of DNA (AT DNA).
    GO:0008301    DNA binding, bending    The activity of binding selectively and non-covalently to and distorting the original structure of DNA, typically a straight helix, into a bend, or increasing the bend if the original structure was intrinsically bent due to its sequence.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0042277    peptide binding    Interacting selectively and non-covalently with peptides, any of a group of organic compounds comprising two or more amino acids linked by peptide bonds.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0071493    cellular response to UV-B    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a UV-B radiation stimulus. UV-B radiation (UV-B light) spans the wavelengths 280 to 315 nm.
    GO:0071236    cellular response to antibiotic    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an antibiotic stimulus. An antibiotic is a chemical substance produced by a microorganism which has the capacity to inhibit the growth of or to kill other microorganisms.
    GO:0008630    intrinsic apoptotic signaling pathway in response to DNA damage    A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the detection of DNA damage, and ends when the execution phase of apoptosis is triggered.
    GO:0010043    response to zinc ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a zinc ion stimulus.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    His A:53 - Pro A:54   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - model 1, sites PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1iml
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CRIP1_MOUSE | P63254
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CRIP1_RAT | P63255
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CRIP1_MOUSE | P63254
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CRIP1_RAT | P63255
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1IML)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1IML)