Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE ANALYSIS OF THE TM107
 
Authors :  R. Zhang, A. Joachimiak, A. Edwards, A. Savchenko, S. Beasley, E. Evdok Midwest Center For Structural Genomics (Mcsg)
Date :  08 May 01  (Deposition) - 10 Oct 01  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (2x)
Biol. Unit 2:  B  (2x)
Biol. Unit 3:  A (2x),B (2x)
Keywords :  New Fold, Structural Genomics, Psi, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. G. Zhang, T. Skarina, J. E. Katz, S. Beasley, A. Khachatryan, S. Vyas C. H. Arrowsmith, S. Clarke, A. Edwards, A. Joachimiak, A. Savchenko
Structure Of Thermotoga Maritima Stationary Phase Survival Protein Sure: A Novel Acid Phosphatase.
Structure V. 9 1095 2001
PubMed-ID: 11709173  |  Reference-DOI: 10.1016/S0969-2126(01)00675-X

(-) Compounds

Molecule 1 - STATIONARY-PHASE SURVIVAL PROTEIN SURE HOMOLOG
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET15B
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Organism Scientific: THERMOTOGA MARITIMA
    Organism Taxid: 2336
    Synonym: SURE PROTEIN, TM107

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (2x): A 
Biological Unit 2 (2x):  B
Biological Unit 3 (2x): A (2x)B (2x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 22)

Asymmetric Unit (1, 22)
No.NameCountTypeFull Name
1MSE22Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 22)
No.NameCountTypeFull Name
1MSE22Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (1, 22)
No.NameCountTypeFull Name
1MSE22Mod. Amino AcidSELENOMETHIONINE
Biological Unit 3 (1, 22)
No.NameCountTypeFull Name
1MSE22Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1ILV)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1ILV)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1ILV)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1ILV)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1ILV)

(-) Exons   (0, 0)

(no "Exon" information available for 1ILV)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:246
 aligned with SURE_THEMA | P96112 from UniProtKB/Swiss-Prot  Length:247

    Alignment length:246
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240      
           SURE_THEMA     1 MRILVTNDDGIQSKGIIVLAELLSEEHEVFVVAPDKERSATGHSITIHVPLWMKKVFISERVVAYSTTGTPADCVKLAYNVVMDKRVDLIVSGVNRGPNMGMDILHSGTVSGAMEGAMMNIPSIAISSANYESPDFEGAARFLIDFLKEFDFSLLDPFTMLNINVPAGEIKGWRFTRQSRRRWNDYFEERVSPFGEKYYWMMGEVIEDDDRDDVDYKAVREGYVSITPIHPFLTNEQCLKKLREVY 246
               SCOP domains d1ilva_ A: SurE homolog TM1662                                                                                                                                                                                                                         SCOP domains
               CATH domains -1ilvA00 A:2-246  [code=3.40.1210.10, no name defined]                                                                                                                                                                                                 CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee......hhhhhhhhhhhhh..eeeeeee..................eeeeeee..eeeeee..hhhhhhhhhhhhh......eeeeeeee...hhhhhhhhhhhhhhhhhhhh...eeeeee......hhhhhhhhhhhhhh..hhhhh....eeeeee......eeee......eeeeeeeeee.....eeeeeeeeee.......hhhhhhhh.eeeeeee.....hhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1ilv A   1 mRILVTNDDGIQSKGIIVLAELLSEEHEVFVVAPDKERSATGHSITIHVPLWmKKVFISERVVAYSTTGTPADCVKLAYNVVmDKRVDLIVSGVNRGPNmGmDILHSGTVSGAmEGAmmNIPSIAISSANYESPDFEGAARFLIDFLKEFDFSLLDPFTmLNINVPAGEIKGWRFTRQSRRRWNDYFEERVSPFGEKYYWmmGEVIEDDDRDDVDYKAVREGYVSITPIHPFLTNEQCLKKLREVY 246
                            |       10        20        30        40        50  |     60        70        80  |     90       100 |     110   |   120       130       140       150       160       170       180       190       200||     210       220       230       240      
                            |                                                  53-MSE                        83-MSE          100-MSE       114-MSE|                                      160-MSE                                  201-MSE                                         
                            1-MSE                                                                                              102-MSE         118-MSE                                                                             202-MSE                                        
                                                                                                                                                119-MSE                                                                                                                           


Chain B from PDB  Type:PROTEIN  Length:247
 aligned with SURE_THEMA | P96112 from UniProtKB/Swiss-Prot  Length:247

    Alignment length:247
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       
           SURE_THEMA     1 MRILVTNDDGIQSKGIIVLAELLSEEHEVFVVAPDKERSATGHSITIHVPLWMKKVFISERVVAYSTTGTPADCVKLAYNVVMDKRVDLIVSGVNRGPNMGMDILHSGTVSGAMEGAMMNIPSIAISSANYESPDFEGAARFLIDFLKEFDFSLLDPFTMLNINVPAGEIKGWRFTRQSRRRWNDYFEERVSPFGEKYYWMMGEVIEDDDRDDVDYKAVREGYVSITPIHPFLTNEQCLKKLREVYD 247
               SCOP domains d1ilvb_ B: SurE homolog TM1662                                                                                                                                                                                                                          SCOP domains
               CATH domains -1ilvB00 B:2-247  [code=3.40.1210.10, no name defined]                                                                                                                                                                                                  CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee......hhhhhhhhhhhh...eeeeeee..................eee.......eeeee..hhhhhhhhhhhhh......eeeeeeee...hhhhhhhhhhhhhhhhhhhh...eeeeee......hhhhhhhhhhhhhhhhhhhhh....eeeeee......eeee......eeeeeeeeee.....eeeeeeeeee.......hhhhhhhh.eeeeeee.....hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ilv B   1 mRILVTNDDGIQSKGIIVLAELLSEEHEVFVVAPDKERSATGHSITIHVPLWmKKVFISERVVAYSTTGTPADCVKLAYNVVmDKRVDLIVSGVNRGPNmGmDILHSGTVSGAmEGAmmNIPSIAISSANYESPDFEGAARFLIDFLKEFDFSLLDPFTmLNINVPAGEIKGWRFTRQSRRRWNDYFEERVSPFGEKYYWmmGEVIEDDDRDDVDYKAVREGYVSITPIHPFLTNEQCLKKLREVYD 247
                            |       10        20        30        40        50  |     60        70        80  |     90       100 |     110   |   120       130       140       150       160       170       180       190       200||     210       220       230       240       
                            1-MSE                                              53-MSE                        83-MSE          100-MSE       114-MSE|                                      160-MSE                                  201-MSE                                          
                                                                                                                               102-MSE         118-MSE                                                                             202-MSE                                         
                                                                                                                                                119-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1ILV)

(-) Gene Ontology  (7, 7)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (SURE_THEMA | P96112)
molecular function
    GO:0008253    5'-nucleotidase activity    Catalysis of the reaction: a 5'-ribonucleotide + H2O = a ribonucleoside + phosphate.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0008252    nucleotidase activity    Catalysis of the reaction: a nucleotide + H2O = a nucleoside + phosphate.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
    GO:0016311    dephosphorylation    The process of removing one or more phosphoric (ester or anhydride) residues from a molecule.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1ilv)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ilv)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ilv
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SURE_THEMA | P96112
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  SURE_THEMA | P96112
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SURE_THEMA | P96112: 1j9j 1j9k 1j9l

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1ILV)