1II2 - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF PHOSPHOENOLPYRUVATE CARBOXYKINASE (PEPCK) FROM TRYPANOSOMA CRUZI

Authors :   S. Trapani, J. Linss, S. Goldenberg, H. Fischer, A. F. Craievich, G. Oliva

Date :   20 Apr 01 (Deposition) - 21 Nov 01 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.00

Chains :   Asym./Biol. Unit : A,B

Keywords :   Phosphate Binding Loop, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Trapani, J. Linss, S. Goldenberg, H. Fischer, A. F. Craievich, G. Oliva
Crystal Structure Of The Dimeric Phosphoenolpyruvate Carboxykinase (Pepck) From Trypanosoma Cruzi At 2 A Resolution.
J. Mol. Biol. V. 313 1059 2001
PubMed-ID: 11700062 | Reference-DOI: 10.1006/JMBI.2001.5093
(for further references see the PDB file header)

Molecule 1 - PHOSPHOENOLPYRUVATE CARBOXYKINASE
	Chains	:	A, B
	EC Number	:	4.1.1.32
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PGEX
	Expression System Strain	:	E1786
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Organism Scientific	:	TRYPANOSOMA CRUZI
	Organism Taxid	:	5693

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 2)

No.	Name	Count	Type	Full Name
1	SO4	2	Ligand/Ion	SULFATE ION

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLY A:224 , THR A:225 , GLY A:226 , LYS A:227 , THR A:228 , THR A:229 , HOH A:593 , HOH A:639 , HOH A:652 , HOH A:730	BINDING SITE FOR RESIDUE SO4 A 1
2	AC2	SOFTWARE	GLY B:224 , THR B:225 , GLY B:226 , LYS B:227 , THR B:228 , THR B:229 , HOH B:627 , HOH B:628 , HOH B:647 , HOH B:655 , HOH B:904	BINDING SITE FOR RESIDUE SO4 B 526

(no "SS Bond" information available for 1II2)

(no "Cis Peptide Bond" information available for 1II2)

(no "SAP(SNP)/Variant" information available for 1II2)

Asymmetric/Biological Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PEPCK_ATP	PS00532	Phosphoenolpyruvate carboxykinase (ATP) signature.	PCKA_TRYCR	238-253	2	A:238-253 B:238-253

(no "Exon" information available for 1II2)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:522
 aligned with PCKA_TRYCR | P51058 from UniProtKB/Swiss-Prot  Length:472

    Alignment length:522
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 457                                          458           472       
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451     |   -         -         -         -         -|      467    |    -  
           PCKA_TRYCR     2 PPTIHRNLLSPELVQWALKIEKDSRLTARGALAVMSYAKTGRSPLDKRIVDTDDVRENVDWGKVNMKLSEESFARVRKIAKEFLDTREHLFVVDCFAGHDERYRLKVRVFTTRPYHALFMRDMLIVPTPEELATFGEPDYVIYNAGECKADPSIPGLTSTTCVALNFKTREQVILGTEYAGEMKKGILTVMFELMPQMNHLCMHASANVGKQGDVTVFFGLSGTGKTTLSADPHRNLIGDDEHVWTDRGVFNIEGGCYAKAIGLNPKTEKDIYDAVRFGAVAENCVLDKRTGEIDFYDESICKNTRVAYPLSHIEGALSKAIAGHPKNVIFLTNDAFGVMPPVARLTSAQAMFWFVMGYTANVPGVEAGGTRTARPIFSSCFGGPFLVRHATFYGEQLAEKMQKHNSRVWLLNTGYAGGRADRGAKRMPLRVTRAIIDAIHDGTLDRTEYEEYPGW--------------------------------------------ACTSRSTSPKCRSIC-------   -
               SCOP domains d1ii2a2 A:2-200 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase)                                                                                                               d1ii2a1 A:201-523 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase)                                                                                                                                                                                                                                          SCOP domains
               CATH domains 1ii2A01             1ii2A02             ----1ii2A01 A:2-21,A:46-200 Phosphoenolpyruvate Carboxykinase, domain 1                                                                                        1ii2A03 A:201-256,A:318-517                             1ii2A02 A:22-41,A:257-315                                  --1ii2A03 A:201-256,A:318-517  [code=3.90.228.20, no name defined]                                                                                                                                        ------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeee..hhhhhhhhhhhhh...ee.....eee........hhh.eeee.hhhhhh.........eehhhhhhhhhhhhhhhhhh..eeeeeeeee.......eeeeeee.hhhhhhhhhhhh...hhhhhhh.....eeeeee................eeeee....eeeee....hhhhhhhhhhhhhhhhhhh..eee.eeeee.....eeeee.....hhhhhhh....eeee...eee....eee...eeeee........hhhhhhh.....eee......................eeeee.hhh.......ee..eeeeeeee.........eeeehhhhhhhhhhhheeee............eeee.hhhhhhhh..hhhhhhhhhhhhhhhhh.eeeeee..ee..hhhhh.ee.hhhhhhhhhhhhhh.hhhhh.eeee....eeee......hhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PEPCK_ATP       ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1ii2 A   2 PPTIHRNLLSPELVQWALKIEKDSRLTARGALAVMSYAKTGRSPLDKRIVDTDDVRENVDWGKVNMKLSEESFARVRKIAKEFLDTREHLFVVDCFAGHDERYRLKVRVFTTRPYHALFMRDMLIVPTPEELATFGEPDYVIYNAGECKADPSIPGLTSTTCVALNFKTREQVILGTEYAGEMKKGILTVMFELMPQMNHLCMHASANVGKQGDVTVFFGLSGTGKTTLSADPHRNLIGDDEHVWTDRGVFNIEGGCYAKAIGLNPKTEKDIYDAVRFGAVAENCVLDKRTGEIDFYDESICKNTRVAYPLSHIEGALSKAIAGHPKNVIFLTNDAFGVMPPVARLTSAQAMFWFVMGYTANVPGVEAGGTRTARPIFSSCFGGPFLVRHATFYGEQLAEKMQKHNSRVWLLNTGYAGGRADRGAKRMPLRVTRAIIDAIHDGTLDRTEYEEYPGWGLHIPKYVAKVPEHLLNPRKAWKDVRQFNETSKELVAMFQESFSARFAAKASQEMKSAVPRYVEFA 523
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521

Chain B from PDB  Type:PROTEIN  Length:514
 aligned with PCKA_TRYCR | P51058 from UniProtKB/Swiss-Prot  Length:472

    Alignment length:522
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 457                                          458           472       
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451     |   -         -         -         -         -|      467    |    -  
           PCKA_TRYCR     2 PPTIHRNLLSPELVQWALKIEKDSRLTARGALAVMSYAKTGRSPLDKRIVDTDDVRENVDWGKVNMKLSEESFARVRKIAKEFLDTREHLFVVDCFAGHDERYRLKVRVFTTRPYHALFMRDMLIVPTPEELATFGEPDYVIYNAGECKADPSIPGLTSTTCVALNFKTREQVILGTEYAGEMKKGILTVMFELMPQMNHLCMHASANVGKQGDVTVFFGLSGTGKTTLSADPHRNLIGDDEHVWTDRGVFNIEGGCYAKAIGLNPKTEKDIYDAVRFGAVAENCVLDKRTGEIDFYDESICKNTRVAYPLSHIEGALSKAIAGHPKNVIFLTNDAFGVMPPVARLTSAQAMFWFVMGYTANVPGVEAGGTRTARPIFSSCFGGPFLVRHATFYGEQLAEKMQKHNSRVWLLNTGYAGGRADRGAKRMPLRVTRAIIDAIHDGTLDRTEYEEYPGW--------------------------------------------ACTSRSTSPKCRSIC-------   -
               SCOP domains d1ii2b2 B:2-200 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase)                                                                                                               d1ii2b1 B:201-523 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase)                                                                                                                                                                                                                                          SCOP domains
               CATH domains 1ii2B01 B:2-24,B:46-2001ii2B02          ----1ii2B01 B:2-24,B:46-200 Phosphoenolpyruvate Carboxykinase, domain 1                                                                                        1ii2B03 B:201-256,B:318-517                             1ii2B02 B:25-41,B:257-315                                  --1ii2B03 B:201-256,B:318-517  [code=3.90.228.20,         no name defined]                                                                                                                                ------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeee..hhhhhhhhhhhhh...ee.....eee........hhh.eeee................eehhhhhhhhhhhhhhhhh...eeeeeeeee.......eeeeeee.hhhhhhhhhhhh...hhhhhhh.....eeeeee................eeeee....eeeee....hhhhhhhhhhhhhhhhhhh..eee.eeeee.....eeeee.....hhhhhhh....eeee...eee....eee...eeeee........hhhhhhhh....eee..ee......ee..........eeeee.hhh.......ee....eeeeee.........eeeehhhhhhhhhhhheeee..--------..eeee.hhhh......hhhhhhhhhhhhhhhhh.eeeeee..ee..hhhhh.ee.hhhhhhhhhhhhhhh......eeee....eeee......hhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PEPCK_ATP       ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1ii2 B   2 PPTIHRNLLSPELVQWALKIEKDSRLTARGALAVMSYAKTGRSPLDKRIVDTDDVRENVDWGKVNMKLSEESFARVRKIAKEFLDTREHLFVVDCFAGHDERYRLKVRVFTTRPYHALFMRDMLIVPTPEELATFGEPDYVIYNAGECKADPSIPGLTSTTCVALNFKTREQVILGTEYAGEMKKGILTVMFELMPQMNHLCMHASANVGKQGDVTVFFGLSGTGKTTLSADPHRNLIGDDEHVWTDRGVFNIEGGCYAKAIGLNPKTEKDIYDAVRFGAVAENCVLDKRTGEIDFYDESICKNTRVAYPLSHIEGALSKAIAGHPKNVIFLTNDAFGVMPPVARLTSAQAMFWFVMGYTANVP--------TARPIFSSCFGGPFLVRHATFYGEQLAEKMQKHNSRVWLLNTGYAGGRADRGAKRMPLRVTRAIIDAIHDGTLDRTEYEEYPGWGLHIPKYVAKVPEHLLNPRKAWKDVRQFNETSKELVAMFQESFSARFAAKASQEMKSAVPRYVEFA 523
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361   |     -  |    381       391       401       411       421       431       441       451       461       471       481       491       501       511       521  
                                                                                                                                                                                                                                                                                                                                                                                                     365      374

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "Pfam Domain" information available for 1II2)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (PCKA_TRYCR | P51058)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0016831	carboxy-lyase activity	Catalysis of the nonhydrolytic addition or removal of a carboxyl group to or from a compound.
	GO:0016829	lyase activity	Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0004612	phosphoenolpyruvate carboxykinase (ATP) activity	Catalysis of the reaction: ATP + oxaloacetate = ADP + CO(2) + H(+) + phosphoenolpyruvate.
	GO:0004611	phosphoenolpyruvate carboxykinase activity	Catalysis of the reaction: source of phosphate + oxaloacetate = phosphoenolpyruvate + CO2 + other reaction products.
	GO:0017076	purine nucleotide binding	Interacting selectively and non-covalently with purine nucleotides, any compound consisting of a purine nucleoside esterified with (ortho)phosphate.
biological process
	GO:0006094	gluconeogenesis	The formation of glucose from noncarbohydrate precursors, such as pyruvate, amino acids and glycerol.
cellular component
	GO:0020015	glycosome	A membrane-bounded organelle found in organisms from the order Kinetoplastida that houses the enzymes of glycolysis.
	GO:0005777	peroxisome	A small organelle enclosed by a single membrane, and found in most eukaryotic cells. Contains peroxidases and other enzymes involved in a variety of metabolic processes including free radical detoxification, lipid catabolism and biosynthesis, and hydrogen peroxide metabolism.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ii2)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1ii2
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PCKA_TRYCR \| P51058
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	4.1.1.32
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PCKA_TRYCR \| P51058
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 1II2)

(no "Related Entries Specified in the PDB File" available for 1II2)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (3, 6)

Pfam Domains (0, 0)

Gene Ontology (10, 10)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File