Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  PECTIN LYASE A
 
Authors :  O. Mayans, M. Scott, I. Connerton, T. Gravesen, J. Benen, J. Visser, R. Pickersgill, J. Jenkins
Date :  04 Oct 96  (Deposition) - 15 Oct 97  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.40
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Lyase, Signal, Glycoprotein, Multigene Family (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  O. Mayans, M. Scott, I. Connerton, T. Gravesen, J. Benen, J. Visser, R. Pickersgill, J. Jenkins
Two Crystal Structures Of Pectin Lyase A From Aspergillus Reveal A Ph Driven Conformational Change And Striking Divergence In The Substrate-Binding Clefts Of Pectin And Pectate Lyases.
Structure V. 5 677 1997
PubMed-ID: 9195887  |  Reference-DOI: 10.1016/S0969-2126(97)00222-0
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PECTIN LYASE A
    ChainsA, B
    EC Number4.2.2.10
    Organism ScientificASPERGILLUS NIGER
    Organism Taxid5061
    Other DetailsSECRETED PROTEIN
    StrainN400

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1IDJ)

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1CAAUNKNOWNASP A:154 , ARG A:176 , ARG A:236THIS IS THE PROPOSED ACTIVE SITE FOR THE ENZYME
2CABUNKNOWNASP B:154 , ARG B:176 , ARG B:236THIS IS THE PROPOSED ACTIVE SITE FOR THE ENZYME

(-) SS Bonds  (6, 6)

Asymmetric Unit
No.Residues
1A:63 -A:82
2A:72 -A:206
3A:302 -A:310
4B:63 -B:82
5B:72 -B:206
6B:302 -B:310

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Ser A:237 -Pro A:238
2Ser B:237 -Pro B:238

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (9, 18)

Asymmetric Unit (9, 18)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_PELA_ASPNG_001 *E32KPELA_ASPNG  ---  ---A/BE12K
2UniProtVAR_PELA_ASPNG_002 *D39SPELA_ASPNG  ---  ---A/BD19S
3UniProtVAR_PELA_ASPNG_003 *V121TPELA_ASPNG  ---  ---A/BV101T
4UniProtVAR_PELA_ASPNG_004 *G233APELA_ASPNG  ---  ---A/BG213A
5UniProtVAR_PELA_ASPNG_005 *C268APELA_ASPNG  ---  ---A/BC248A
6UniProtVAR_PELA_ASPNG_006 *F273WPELA_ASPNG  ---  ---A/BF253W
7UniProtVAR_PELA_ASPNG_007 *A309EPELA_ASPNG  ---  ---A/BA289E
8UniProtVAR_PELA_ASPNG_008 *T316SPELA_ASPNG  ---  ---A/BT296S
9UniProtVAR_PELA_ASPNG_009 *C337SPELA_ASPNG  ---  ---A/BC317S
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (9, 9)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_PELA_ASPNG_001 *E32KPELA_ASPNG  ---  ---AE12K
2UniProtVAR_PELA_ASPNG_002 *D39SPELA_ASPNG  ---  ---AD19S
3UniProtVAR_PELA_ASPNG_003 *V121TPELA_ASPNG  ---  ---AV101T
4UniProtVAR_PELA_ASPNG_004 *G233APELA_ASPNG  ---  ---AG213A
5UniProtVAR_PELA_ASPNG_005 *C268APELA_ASPNG  ---  ---AC248A
6UniProtVAR_PELA_ASPNG_006 *F273WPELA_ASPNG  ---  ---AF253W
7UniProtVAR_PELA_ASPNG_007 *A309EPELA_ASPNG  ---  ---AA289E
8UniProtVAR_PELA_ASPNG_008 *T316SPELA_ASPNG  ---  ---AT296S
9UniProtVAR_PELA_ASPNG_009 *C337SPELA_ASPNG  ---  ---AC317S
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (9, 9)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_PELA_ASPNG_001 *E32KPELA_ASPNG  ---  ---BE12K
2UniProtVAR_PELA_ASPNG_002 *D39SPELA_ASPNG  ---  ---BD19S
3UniProtVAR_PELA_ASPNG_003 *V121TPELA_ASPNG  ---  ---BV101T
4UniProtVAR_PELA_ASPNG_004 *G233APELA_ASPNG  ---  ---BG213A
5UniProtVAR_PELA_ASPNG_005 *C268APELA_ASPNG  ---  ---BC248A
6UniProtVAR_PELA_ASPNG_006 *F273WPELA_ASPNG  ---  ---BF253W
7UniProtVAR_PELA_ASPNG_007 *A309EPELA_ASPNG  ---  ---BA289E
8UniProtVAR_PELA_ASPNG_008 *T316SPELA_ASPNG  ---  ---BT296S
9UniProtVAR_PELA_ASPNG_009 *C337SPELA_ASPNG  ---  ---BC317S
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1IDJ)

(-) Exons   (0, 0)

(no "Exon" information available for 1IDJ)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:359
 aligned with PELA_ASPNG | Q01172 from UniProtKB/Swiss-Prot  Length:379

    Alignment length:359
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370         
           PELA_ASPNG    21 VGVSGSAEGFAEGVTGGGDATPVYPDTIDELVSYLGDDEARVIVLTKTFDFTDSEGTTTGTGCAPWGTASACQVAIDQDDWCENYEPDAPSVSVEYYNAGVLGITVTSNKSLIGEGSSGAIKGKGLRIVSGAENIIIQNIAVTDINPKYVWGGDAITLDDCDLVWIDHVTTARIGRQHYVLGTSADNRVSLTNNYIDGVSDYSATCDGYHYWGIYLDGDADLVTMKGNYIYHTSGRSPKVQDNTLLHCVNNYFYDISGHAFEIGEGGYVLAEGNVFQNVDTVLETYEGAAFTVPSTTAGEVCSTYLGRDCVINGFGCSGTFSEDSTSFLSDFEGKNIASASAYTSVASRVVANAGQGNL 379
               SCOP domains d1idja_ A: Pectin lyase                                                                                                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains 1idjA00 A:1-359 Single-stranded right-handed beta-helix, Pectin lyase-like                                                                                                                                                                                                                                                                                              CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........................hhhhhhhh.....eeeee..eee......eeeeeeee.........................eeeeeeee......eee...eeeee.....eee...eeee.....eeee..eee............eeee....eeee..eee......eee.....eeeeee..eee................eee....eeeeee..eee............eeeeee..eee......eee...eeeeee..eee.....eeee..eee......hhhhhhhhh.......eee..........hhhhhh..........hhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) -----------K------S---------------------------------------------------------------------------------T---------------------------------------------------------------------------------------------------------------A----------------------------------A----W-----------------------------------E------S--------------------S------------------------------------------ SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1idj A   1 VGVSGSAEGFAEGVTGGGDATPVYPDTIDELVSYLGDDEARVIVLTKTFDFTDSEGTTTGTGCAPWGTASACQVAIDQDDWCENYEPDAPSVSVEYYNAGVLGITVTSNKSLIGEGSSGAIKGKGLRIVSGAENIIIQNIAVTDINPKYVWGGDAITLDDCDLVWIDHVTTARIGRQHYVLGTSADNRVSLTNNYIDGVSDYSATCDGYHYWGIYLDGDADLVTMKGNYIYHTSGRSPKVQDNTLLHCVNNYFYDISGHAFEIGEGGYVLAEGNVFQNVDTVLETYEGAAFTVPSTTAGEVCSTYLGRDCVINGFGCSGTFSEDSTSFLSDFEGKNIASASAYTSVASRVVANAGQGNL 359
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350         

Chain B from PDB  Type:PROTEIN  Length:359
 aligned with PELA_ASPNG | Q01172 from UniProtKB/Swiss-Prot  Length:379

    Alignment length:359
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370         
           PELA_ASPNG    21 VGVSGSAEGFAEGVTGGGDATPVYPDTIDELVSYLGDDEARVIVLTKTFDFTDSEGTTTGTGCAPWGTASACQVAIDQDDWCENYEPDAPSVSVEYYNAGVLGITVTSNKSLIGEGSSGAIKGKGLRIVSGAENIIIQNIAVTDINPKYVWGGDAITLDDCDLVWIDHVTTARIGRQHYVLGTSADNRVSLTNNYIDGVSDYSATCDGYHYWGIYLDGDADLVTMKGNYIYHTSGRSPKVQDNTLLHCVNNYFYDISGHAFEIGEGGYVLAEGNVFQNVDTVLETYEGAAFTVPSTTAGEVCSTYLGRDCVINGFGCSGTFSEDSTSFLSDFEGKNIASASAYTSVASRVVANAGQGNL 379
               SCOP domains d1idjb_ B: Pectin lyase                                                                                                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains 1idjB00 B:1-359 Single-stranded right-handed beta-helix, Pectin lyase-like                                                                                                                                                                                                                                                                                              CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........................hhhhhhhh.....eeeee..eee......eeeeeeee.........................eeeeeeee......eee...eeeee.....eee...eeee.....eeee..eee............eeee....eeee..eee......eee.....eeeeee..eee................eee....eeeeee..eee............eeeeee..eee......eee...eeeeee..eee.....eeee..eee......hhhhhhhhh.......eee..........hhhhhh..........hhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) -----------K------S---------------------------------------------------------------------------------T---------------------------------------------------------------------------------------------------------------A----------------------------------A----W-----------------------------------E------S--------------------S------------------------------------------ SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1idj B   1 VGVSGSAEGFAEGVTGGGDATPVYPDTIDELVSYLGDDEARVIVLTKTFDFTDSEGTTTGTGCAPWGTASACQVAIDQDDWCENYEPDAPSVSVEYYNAGVLGITVTSNKSLIGEGSSGAIKGKGLRIVSGAENIIIQNIAVTDINPKYVWGGDAITLDDCDLVWIDHVTTARIGRQHYVLGTSADNRVSLTNNYIDGVSDYSATCDGYHYWGIYLDGDADLVTMKGNYIYHTSGRSPKVQDNTLLHCVNNYFYDISGHAFEIGEGGYVLAEGNVFQNVDTVLETYEGAAFTVPSTTAGEVCSTYLGRDCVINGFGCSGTFSEDSTSFLSDFEGKNIASASAYTSVASRVVANAGQGNL 359
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1IDJ)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (PELA_ASPNG | Q01172)
molecular function
    GO:0016829    lyase activity    Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
    GO:0047490    pectin lyase activity    Catalysis of the reaction: a pectin = an oligosaccharide with 4-deoxy-6-O-methyl-alpha-D-galact-4-enuronate end + a pectin. This reaction is the eliminative cleavage of (1->4)-alpha-D-galacturonan methyl ester to give oligosaccharides with 4-deoxy-6-O-methyl-alpha-D-galact-4-enuronosyl groups at their nonreducing ends.
biological process
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
    GO:0071555    cell wall organization    A process that results in the assembly, arrangement of constituent parts, or disassembly of the cell wall, the rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal and most prokaryotic cells, maintaining their shape and protecting them from osmotic lysis.
    GO:0000272    polysaccharide catabolic process    The chemical reactions and pathways resulting in the breakdown of a polysaccharide, a polymer of many (typically more than 10) monosaccharide residues linked glycosidically.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1idj)
 
  Sites
    CAA  [ RasMol ]  +environment [ RasMol ]
    CAB  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ser A:237 - Pro A:238   [ RasMol ]  
    Ser B:237 - Pro B:238   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1idj
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PELA_ASPNG | Q01172
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  4.2.2.10
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PELA_ASPNG | Q01172
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PELA_ASPNG | Q011721idk

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1IDJ)