Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURAL GENOMICS, IOLI PROTEIN
 
Authors :  R. Zhang, I. Dementieva, F. Collart, E. Quaite-Randall, A. Joachimiak, Midwest Center For Structural Genomics (Mcsg)
Date :  01 Mar 01  (Deposition) - 13 Mar 02  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym./Biol. Unit :  A
Keywords :  Beta Barrel, Structural Genomics, Psi, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Zhang, I. Dementieva, N. Duke, F. Collart, E. Quaite-Randall, R. Alkire, L. Dieckman, N. Maltsev, O. Korolev, A. Joachimiak
Crystal Structure Of Bacillus Subtilis Ioli Shows Endonuclase Iv Fold With Altered Zn Binding.
Proteins V. 48 423 2002
PubMed-ID: 12112707  |  Reference-DOI: 10.1002/PROT.10159
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - IOLI PROTEIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET30XALIC
    Expression System Strain: BL21(DE3)PLYSS
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: IOLI OR B65B
    Organism Scientific: BACILLUS SUBTILIS
    Organism Taxid: 1423

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 6)

Asymmetric/Biological Unit (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1I60)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1I60)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1I60)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1I60)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1I60)

(-) Exons   (0, 0)

(no "Exon" information available for 1I60)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:278
 aligned with IOLI_BACSU | P42419 from UniProtKB/Swiss-Prot  Length:278

    Alignment length:278
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270        
           IOLI_BACSU     1 MKLCFNEATTLENSNLKLDLELCEKHGYDYIEIRTMDKLPEYLKDHSLDDLAEYFQTHHIKPLALNALVFFNNRDEKGHNEIITEFKGMMETCKTLGVKYVVAVPLVTEQKIVKEEIKKSSVDVLTELSDIAEPYGVKIALEFVGHPQCTVNTFEQAYEIVNTVNRDNVGLVLDSFHFHAMGSNIESLKQADGKKIFIYHIDDTEDFPIGFLTDEDRVWPGQGAIDLDAHLSALKEIGFSDVVSVELFRPEYYKLTAEEAIQTAKKTTVDVVSKYFSM 278
               SCOP domains d1i60a_ A: Hypothetical protein IolI                                                                                                                                                                                                                                                   SCOP domains
               CATH domains -1i60A00 A:2-277 Divalent-metal-dependent TIM barrel enzymes                                                                                                                                                                                                                         - CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee.hhhh...hhhhhhhhhhhh...eeeee..hhhhhhh...hhhhhhhhhhh...eeeeeeeee.....hhhhhhhhhhhhhhhhhhhhhhh..eeeee........hhhhhhhhhhhhhhhhhhhhhhhh.eeeee..........hhhhhhhhhhhhh...eeeeeehhhhhhh..hhhhhhh.hhh.eeeeee.ee........hhh.ee.......hhhhhhhhhhhh....eeee...hhhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1i60 A   1 mKLCFNEATTLENSNLKLDLELCEKHGYDYIEIRTmDKLPEYLKDHSLDDLAEYFQTHHIKPLALNALVFFNNRDEKGHNEIITEFKGmmETCKTLGVKYVVAVPLVTEQKIVKEEIKKSSVDVLTELSDIAEPYGVKIALEFVGHPQCTVNTFEQAYEIVNTVNRDNVGLVLDSFHFHAmGSNIESLKQADGKKIFIYHIDDTEDFPIGFLTDEDRVWPGQGAIDLDAHLSALKEIGFSDVVSVELFRPEYYKLTAEEAIQTAKKTTVDVVSKYFSm 278
                            |       10        20        30     |  40        50        60        70        80        90       100       110       120       130       140       150       160       170       180|      190       200       210       220       230       240       250       260       270       |
                            |                                 36-MSE                                               89-MSE                                                                                     181-MSE                                                                                          278-MSE
                            1-MSE                                                                                   90-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1I60)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (IOLI_BACSU | P42419)
molecular function
    GO:0016853    isomerase activity    Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1i60)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1i60)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1i60
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IOLI_BACSU | P42419
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  IOLI_BACSU | P42419
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        IOLI_BACSU | P42419: 1i6n

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1I60)