1I0E - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF CREATINE KINASE FROM HUMAN MUSCLE

Authors :   Y. -Q. Shen, L. Tang, H. -M. Zhou, Z. -J. Lin

Date :   29 Jan 01 (Deposition) - 01 Apr 03 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.50

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A  (2x)
Biol. Unit 2: B  (2x)
Biol. Unit 3: C (1x),D (1x)
Biol. Unit 4: C (1x),D (1x)

Keywords :   Double Helix, Dimer, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Q. Shen, L. Tang, H. M. Zhou, Z. J. Lin
Structure Of Human Muscle Creatine Kinase.
Acta Crystallogr. , Sect. D V. 57 1196 2001
PubMed-ID: 11517911
(for further references see the PDB file header)

Molecule 1 - CREATINE KINASE,M CHAIN
	Chains	:	A, B, C, D
	EC Number	:	2.7.3.2
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Tissue	:	MUSCLE

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (2x)	:	A
Biological Unit 2 (2x)	:		B
Biological Unit 3 (1x)	:			C (1x)	D (1x)
Biological Unit 4 (1x)	:			C (1x)	D (1x)

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1I0E)

(no "Site" information available for 1I0E)

(no "SS Bond" information available for 1I0E)

Asymmetric Unit

No.	Residues
1	Trp A:211	-	Pro A:212
2	Trp B:211	-	Pro B:212
3	Trp C:211	-	Pro C:212
4	Trp D:211	-	Pro D:212

Asymmetric Unit (4, 16)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_018680	E	83	G	KCRM_HUMAN	Polymorphism	11559024	A/B/C/D	E	83	G
2	UniProt	VAR_018681	L	127	V	KCRM_HUMAN	Polymorphism	17875653	A/B/C/D	L	127	V
3	UniProt	VAR_049675	T	166	M	KCRM_HUMAN	Polymorphism	17357122	A/B/C/D	T	166	M
4	UniProt	VAR_018682	G	243	A	KCRM_HUMAN	Polymorphism	17875625	A/B/C/D	G	243	A

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (4, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_018680	E	83	G	KCRM_HUMAN	Polymorphism	11559024	A	E	83	G
2	UniProt	VAR_018681	L	127	V	KCRM_HUMAN	Polymorphism	17875653	A	L	127	V
3	UniProt	VAR_049675	T	166	M	KCRM_HUMAN	Polymorphism	17357122	A	T	166	M
4	UniProt	VAR_018682	G	243	A	KCRM_HUMAN	Polymorphism	17875625	A	G	243	A

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (4, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_018680	E	83	G	KCRM_HUMAN	Polymorphism	11559024	B	E	83	G
2	UniProt	VAR_018681	L	127	V	KCRM_HUMAN	Polymorphism	17875653	B	L	127	V
3	UniProt	VAR_049675	T	166	M	KCRM_HUMAN	Polymorphism	17357122	B	T	166	M
4	UniProt	VAR_018682	G	243	A	KCRM_HUMAN	Polymorphism	17875625	B	G	243	A

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (4, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_018680	E	83	G	KCRM_HUMAN	Polymorphism	11559024	C/D	E	83	G
2	UniProt	VAR_018681	L	127	V	KCRM_HUMAN	Polymorphism	17875653	C/D	L	127	V
3	UniProt	VAR_049675	T	166	M	KCRM_HUMAN	Polymorphism	17357122	C/D	T	166	M
4	UniProt	VAR_018682	G	243	A	KCRM_HUMAN	Polymorphism	17875625	C/D	G	243	A

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (4, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_018680	E	83	G	KCRM_HUMAN	Polymorphism	11559024	C/D	E	83	G
2	UniProt	VAR_018681	L	127	V	KCRM_HUMAN	Polymorphism	17875653	C/D	L	127	V
3	UniProt	VAR_049675	T	166	M	KCRM_HUMAN	Polymorphism	17357122	C/D	T	166	M
4	UniProt	VAR_018682	G	243	A	KCRM_HUMAN	Polymorphism	17875625	C/D	G	243	A

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (3, 12)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PHOSPHAGEN_KINASE_N	PS51509	Phosphagen kinase N-terminal domain profile.	KCRM_HUMAN	11-98	4	A:11-98 B:11-98 C:11-98 D:11-98
2	PHOSPHAGEN_KINASE_C	PS51510	Phosphagen kinase C-terminal domain profile.	KCRM_HUMAN	125-367	4	A:125-367 B:125-367 C:125-367 D:125-367
3	PHOSPHAGEN_KINASE	PS00112	Phosphagen kinase active site signature.	KCRM_HUMAN	283-289	4	A:283-289 B:283-289 C:283-289 D:283-289

Biological Unit 1 (3, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PHOSPHAGEN_KINASE_N	PS51509	Phosphagen kinase N-terminal domain profile.	KCRM_HUMAN	11-98	2	A:11-98 - - -
2	PHOSPHAGEN_KINASE_C	PS51510	Phosphagen kinase C-terminal domain profile.	KCRM_HUMAN	125-367	2	A:125-367 - - -
3	PHOSPHAGEN_KINASE	PS00112	Phosphagen kinase active site signature.	KCRM_HUMAN	283-289	2	A:283-289 - - -

Biological Unit 2 (3, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PHOSPHAGEN_KINASE_N	PS51509	Phosphagen kinase N-terminal domain profile.	KCRM_HUMAN	11-98	2	- B:11-98 - -
2	PHOSPHAGEN_KINASE_C	PS51510	Phosphagen kinase C-terminal domain profile.	KCRM_HUMAN	125-367	2	- B:125-367 - -
3	PHOSPHAGEN_KINASE	PS00112	Phosphagen kinase active site signature.	KCRM_HUMAN	283-289	2	- B:283-289 - -

Biological Unit 3 (3, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PHOSPHAGEN_KINASE_N	PS51509	Phosphagen kinase N-terminal domain profile.	KCRM_HUMAN	11-98	2	- - C:11-98 D:11-98
2	PHOSPHAGEN_KINASE_C	PS51510	Phosphagen kinase C-terminal domain profile.	KCRM_HUMAN	125-367	2	- - C:125-367 D:125-367
3	PHOSPHAGEN_KINASE	PS00112	Phosphagen kinase active site signature.	KCRM_HUMAN	283-289	2	- - C:283-289 D:283-289

Biological Unit 4 (3, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PHOSPHAGEN_KINASE_N	PS51509	Phosphagen kinase N-terminal domain profile.	KCRM_HUMAN	11-98	2	- - C:11-98 D:11-98
2	PHOSPHAGEN_KINASE_C	PS51510	Phosphagen kinase C-terminal domain profile.	KCRM_HUMAN	125-367	2	- - C:125-367 D:125-367
3	PHOSPHAGEN_KINASE	PS00112	Phosphagen kinase active site signature.	KCRM_HUMAN	283-289	2	- - C:283-289 D:283-289

Asymmetric Unit (7, 28)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000221476	1	ENSE00001335081	chr19:45826134-45826079	56	KCRM_HUMAN	-	0	0	-	-
1.2	ENST00000221476	2	ENSE00002184303	chr19:45822989-45822779	211	KCRM_HUMAN	1-65	65	4	A:8-65 B:8-65 C:8-65 D:8-65	58 58 58 58
1.3	ENST00000221476	3	ENSE00001772225	chr19:45821237-45821083	155	KCRM_HUMAN	65-116	52	4	A:65-116 B:65-116 C:65-116 D:65-116	52 52 52 52
1.4a	ENST00000221476	4a	ENSE00000712865	chr19:45818855-45818723	133	KCRM_HUMAN	117-161	45	4	A:117-161 B:117-161 C:117-161 D:117-161	45 45 45 45
1.5	ENST00000221476	5	ENSE00000712863	chr19:45815178-45815007	172	KCRM_HUMAN	161-218	58	4	A:161-218 B:161-218 C:161-218 D:161-218	58 58 58 58
1.6	ENST00000221476	6	ENSE00000712860	chr19:45811790-45811667	124	KCRM_HUMAN	218-259	42	4	A:218-259 B:218-259 C:218-259 D:218-259	42 42 42 42
1.7	ENST00000221476	7	ENSE00000712858	chr19:45810908-45810719	190	KCRM_HUMAN	260-323	64	4	A:260-322 B:260-322 C:260-322 D:260-322	63 63 63 63
1.8	ENST00000221476	8	ENSE00001158571	chr19:45810186-45809672	515	KCRM_HUMAN	323-381	59	4	A:332-381 B:332-381 C:332-381 D:332-381	50 50 50 50

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:365
 aligned with KCRM_HUMAN | P06732 from UniProtKB/Swiss-Prot  Length:381

    Alignment length:374
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377    
           KCRM_HUMAN     8 NKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK 381
               SCOP domains d1i0ea1 A:8-102 Creatine kinase, N-domain                                                      d1i0ea2 A:103-381 Creatine kinase, C-terminal domain                                                                                                                                                                                                                                    SCOP domains
               CATH domains 1i0eA01 A:8-102 Transferase Creatine Kinase, Chain A, domain 1                                 --1i0eA02 A:105-380 Creatine Kinase; Chain                                                                                                                                                                                                                                            - CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhh.......hhhhhhhhhhhhhhhh........hhhhhhhhhhhh...............hhhhhhhhhhhhhhhh...............................eeeeeee..............hhhhhhhhhhhhhhhhhhhhhhh.eeeee.......hhhhhhhh.........................eeeee.....eeee.....eeeeeeee..hhhhhhhhhhhhhhhhhhhhhhh.....ee...ee...hhhhh....eeeeeee........hhhhhhhhh.ee....---------.eeeeee......hhhhhhhhhhhhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------G-------------------------------------------V--------------------------------------M----------------------------------------------------------------------------A------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ---PHOSPHAGEN_KINASE_N  PDB: A:11-98 UniProt: 11-98                                        --------------------------PHOSPHAGEN_KINASE_C  PDB: A:125-367 UniProt: 125-367                                                                                                                                                                                               -------------- PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PHOSPHA-------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2  PDB: A:8-65 UniProt: 1-65 [INCOMPLETE]          ---------------------------------------------------Exon 1.4a  PDB: A:117-161 UniProt: 117-161   --------------------------------------------------------Exon 1.6  PDB: A:218-259 UniProt: 218-259 Exon 1.7  PDB: A:260-322 UniProt: 260-323 [INCOMPLETE]          ---------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------Exon 1.3  PDB: A:65-116 UniProt: 65-116             --------------------------------------------Exon 1.5  PDB: A:161-218 UniProt: 161-218                 --------------------------------------------------------------------------------------------------------Exon 1.8  PDB: A:332-381 UniProt: 323-381 [INCOMPLETE]      Transcript 1 (2)
                 1i0e A   8 NKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGT---------SVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK 381
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317    |    -    |  337       347       357       367       377    
                                                                                                                                                                                                                                                                                                                                                    322       332

Chain B from PDB  Type:PROTEIN  Length:365
 aligned with KCRM_HUMAN | P06732 from UniProtKB/Swiss-Prot  Length:381

    Alignment length:374
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377    
           KCRM_HUMAN     8 NKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK 381
               SCOP domains d1i0eb1 B:8-102 Creatine kinase, N-domain                                                      d1i0eb2 B:103-381 Creatine kinase, C-terminal domain                                                                                                                                                                                                                                    SCOP domains
               CATH domains 1i0eB01 B:8-102 Transferase Creatine Kinase, Chain A, domain 1                                 --1i0eB02 B:105-380 Creatine Kinase; Chain                                                                                                                                                                                                                                            - CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhh.......hhhhhhhhhhhhhhhh........hhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhh............................eeeeeee..............hhhhhhhhhhhhhhhhhhhhhhh.eeeee.......hhhhhhhh.........................eeeee.....eeee.....eeeeeeee..hhhhhhhhhhhhhhhhhhhhhhh.....ee...ee...hhhhh....eeeeeee........hhhhhhhhh.......---------.eeeee.......hhhhhhhhhhhhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------G-------------------------------------------V--------------------------------------M----------------------------------------------------------------------------A------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ---PHOSPHAGEN_KINASE_N  PDB: B:11-98 UniProt: 11-98                                        --------------------------PHOSPHAGEN_KINASE_C  PDB: B:125-367 UniProt: 125-367                                                                                                                                                                                               -------------- PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PHOSPHA-------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2  PDB: B:8-65 UniProt: 1-65 [INCOMPLETE]          ---------------------------------------------------Exon 1.4a  PDB: B:117-161 UniProt: 117-161   --------------------------------------------------------Exon 1.6  PDB: B:218-259 UniProt: 218-259 Exon 1.7  PDB: B:260-322 UniProt: 260-323 [INCOMPLETE]          ---------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------Exon 1.3  PDB: B:65-116 UniProt: 65-116             --------------------------------------------Exon 1.5  PDB: B:161-218 UniProt: 161-218                 --------------------------------------------------------------------------------------------------------Exon 1.8  PDB: B:332-381 UniProt: 323-381 [INCOMPLETE]      Transcript 1 (2)
                 1i0e B   8 NKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGT---------SVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK 381
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317    |    -    |  337       347       357       367       377    
                                                                                                                                                                                                                                                                                                                                                    322       332

Chain C from PDB  Type:PROTEIN  Length:365
 aligned with KCRM_HUMAN | P06732 from UniProtKB/Swiss-Prot  Length:381

    Alignment length:374
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377    
           KCRM_HUMAN     8 NKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK 381
               SCOP domains d1i0ec1 C:8-102 Creatine kinase, N-domain                                                      d1i0ec2 C:103-381 Creatine kinase, C-terminal domain                                                                                                                                                                                                                                    SCOP domains
               CATH domains 1i0eC01 C:8-102 Transferase Creatine Kinase, Chain A, domain 1                                 --1i0eC02 C:105-380 Creatine Kinase; Chain                                                                                                                                                                                                                                            - CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhh.......hhhhhhhhhhhhhhhh........hhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhh............................eeeeeeee.............hhhhhhhhhhhhhhhhhhhhhhh.eeeee.......hhhhhhhh.........................eeeee.....eeee.....eeeeeeee..hhhhhhhhhhhhhhhhhhhhhhh.....ee...ee...hhhhh...eeeeeeee........hhhhhhhhh.ee....---------.eeeeee......hhhhhhhhhhhhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------G-------------------------------------------V--------------------------------------M----------------------------------------------------------------------------A------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ---PHOSPHAGEN_KINASE_N  PDB: C:11-98 UniProt: 11-98                                        --------------------------PHOSPHAGEN_KINASE_C  PDB: C:125-367 UniProt: 125-367                                                                                                                                                                                               -------------- PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PHOSPHA-------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2  PDB: C:8-65 UniProt: 1-65 [INCOMPLETE]          ---------------------------------------------------Exon 1.4a  PDB: C:117-161 UniProt: 117-161   --------------------------------------------------------Exon 1.6  PDB: C:218-259 UniProt: 218-259 Exon 1.7  PDB: C:260-322 UniProt: 260-323 [INCOMPLETE]          ---------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------Exon 1.3  PDB: C:65-116 UniProt: 65-116             --------------------------------------------Exon 1.5  PDB: C:161-218 UniProt: 161-218                 --------------------------------------------------------------------------------------------------------Exon 1.8  PDB: C:332-381 UniProt: 323-381 [INCOMPLETE]      Transcript 1 (2)
                 1i0e C   8 NKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGT---------SVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK 381
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317    |    -    |  337       347       357       367       377    
                                                                                                                                                                                                                                                                                                                                                    322       332

Chain D from PDB  Type:PROTEIN  Length:365
 aligned with KCRM_HUMAN | P06732 from UniProtKB/Swiss-Prot  Length:381

    Alignment length:374
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377    
           KCRM_HUMAN     8 NKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK 381
               SCOP domains d1i0ed1 D:8-102 Creatine kinase, N-domain                                                      d1i0ed2 D:103-381 Creatine kinase, C-terminal domain                                                                                                                                                                                                                                    SCOP domains
               CATH domains 1i0eD01 D:8-102 Transferase Creatine Kinase, Chain A, domain 1                                 --1i0eD02 D:105-380 Creatine Kinase; Chain                                                                                                                                                                                                                                            - CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhh.......hhhhhhhhhhhhhhhh........hhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhh............................eeeeeeee.............hhhhhhhhhhhhhhhhhhhhhhh.eeeee.......hhhhhhhh.........................eeeee.....eeee.....eeeeeeee..hhhhhhhhhhhhhhhhhhhhhhh.....ee...ee...hhhhh...eeeeeeee........hhhhhhhhh.ee....---------.eeeeee......hhhhhhhhhhhhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------G-------------------------------------------V--------------------------------------M----------------------------------------------------------------------------A------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ---PHOSPHAGEN_KINASE_N  PDB: D:11-98 UniProt: 11-98                                        --------------------------PHOSPHAGEN_KINASE_C  PDB: D:125-367 UniProt: 125-367                                                                                                                                                                                               -------------- PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PHOSPHA-------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2  PDB: D:8-65 UniProt: 1-65 [INCOMPLETE]          ---------------------------------------------------Exon 1.4a  PDB: D:117-161 UniProt: 117-161   --------------------------------------------------------Exon 1.6  PDB: D:218-259 UniProt: 218-259 Exon 1.7  PDB: D:260-322 UniProt: 260-323 [INCOMPLETE]          ---------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------Exon 1.3  PDB: D:65-116 UniProt: 65-116             --------------------------------------------Exon 1.5  PDB: D:161-218 UniProt: 161-218                 --------------------------------------------------------------------------------------------------------Exon 1.8  PDB: D:332-381 UniProt: 323-381 [INCOMPLETE]      Transcript 1 (2)
                 1i0e D   8 NKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGT---------SVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK 381
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317    |    -    |  337       347       357       367       377    
                                                                                                                                                                                                                                                                                                                                                    322       332

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Creatine Kinase; Chain A, domain 2 (27)

Homologous Superfamily: Creatine Kinase; Chain (27)

Human (Homo sapiens) (3)

1a	1i0eA02	A:105-380
1b	1i0eB02	B:105-380
1c	1i0eC02	C:105-380
1d	1i0eD02	D:105-380

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Transferase Creatine Kinase; Chain A, domain 1 (26)

Homologous Superfamily: Transferase Creatine Kinase, Chain A, domain 1 (26)

Human (Homo sapiens) (6)

2a	1i0eA01	A:8-102
2b	1i0eB01	B:8-102
2c	1i0eC01	C:8-102
2d	1i0eD01	D:8-102

(no "Pfam Domain" information available for 1I0E)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (KCRM_HUMAN | P06732)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0004111	creatine kinase activity	Catalysis of the reaction: ATP + creatine = N-phosphocreatine + ADP + 2 H(+).
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0016772	transferase activity, transferring phosphorus-containing groups	Catalysis of the transfer of a phosphorus-containing group from one compound (donor) to another (acceptor).
biological process
	GO:0006600	creatine metabolic process	The chemical reactions and pathways involving creatine (N-(aminoiminomethyl)-N-methylglycine), a compound synthesized from the amino acids arginine, glycine, and methionine that occurs in muscle.
	GO:0046314	phosphocreatine biosynthetic process	The chemical reactions and pathways resulting in the formation of phosphocreatine, a phosphagen of creatine which is synthesized and broken down by creatine phosphokinase.
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1i0e)

	Sites
(no "Sites" information available for 1i0e)

	Cis Peptide Bonds
		Trp A:211 - Pro A:212	[ RasMol ]
		Trp B:211 - Pro B:212	[ RasMol ]
		Trp C:211 - Pro C:212	[ RasMol ]
		Trp D:211 - Pro D:212	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1i0e
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	KCRM_HUMAN \| P06732
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.3.2
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	KCRM_HUMAN \| P06732
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 1I0E)

(no "Related Entries Specified in the PDB File" available for 1I0E)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (4, 16)

PROSITE Motifs (3, 12)

Exons (7, 28)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 8)

CATH Domains (2, 8)

Pfam Domains (0, 0)

Gene Ontology (13, 13)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File