Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF CLASS A CEPHALOSPORINASE FROM PROTEUS VULGARIS K1
 
Authors :  M. Nukaga, G. V. Crichlow, A. P. Kuzin, K. Mayama, J. R. Knox
Date :  25 Jan 01  (Deposition) - 03 Apr 02  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.75
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Mixed Alpha/Beta, Cephalosporinase, Class A Beta-Lactamase, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Nukaga, K. Mayama, G. V. Crichlow, J. R. Knox
Structure Of An Extended-Spectrum Class A Beta-Lactamase From Proteus Vulgaris K1.
J. Mol. Biol. V. 317 109 2002
PubMed-ID: 11916382  |  Reference-DOI: 10.1006/JMBI.2002.5420
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - BETA-LACTAMASE
    ChainsA, B
    EC Number3.5.2.6
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPPVCF1
    Expression System StrainAS226-51
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneBLAC
    Organism ScientificPROTEUS VULGARIS
    Organism Taxid585
    StrainK1
    SynonymCEPHALOSPORINASE

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1MES2Ligand/Ion2-(N-MORPHOLINO)-ETHANESULFONIC ACID
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1MES1Ligand/Ion2-(N-MORPHOLINO)-ETHANESULFONIC ACID
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1MES1Ligand/Ion2-(N-MORPHOLINO)-ETHANESULFONIC ACID

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:70 , TYR A:105 , SER A:130 , THR A:216 , LYS A:234 , THR A:235 , GLY A:236 , SER A:237 , HOH A:328 , HOH A:432 , HOH A:547 , HOH A:664BINDING SITE FOR RESIDUE MES A 1000
2AC2SOFTWARESER B:70 , TYR B:105 , SER B:130 , LYS B:234 , THR B:235 , GLY B:236 , SER B:237 , HOH B:340 , HOH B:536 , HOH B:712BINDING SITE FOR RESIDUE MES B 1001

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1HZO)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Glu A:166 -Pro A:167
2Glu B:166 -Pro B:167

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (11, 22)

Asymmetric Unit (11, 22)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_BLAB_PROVU_003 *S40NBLAB_PROVU  ---  ---A/BN34N
02UniProtVAR_BLAB_PROVU_004 *E58KBLAB_PROVU  ---  ---A/BE52K
03UniProtVAR_BLAB_PROVU_005 *E88ABLAB_PROVU  ---  ---A/BA83A
04UniProtVAR_BLAB_PROVU_006 *V119TBLAB_PROVU  ---  ---A/BT114T
05UniProtVAR_BLAB_PROVU_007 *S123TBLAB_PROVU  ---  ---A/BT118T
06UniProtVAR_BLAB_PROVU_008 *Q126EBLAB_PROVU  ---  ---A/BE121E
07UniProtVAR_BLAB_PROVU_009 *H224NBLAB_PROVU  ---  ---A/BN219N
08UniProtVAR_BLAB_PROVU_010 *I235VBLAB_PROVU  ---  ---A/BV230V
09UniProtVAR_BLAB_PROVU_011 *K257EBLAB_PROVU  ---  ---A/BE254E
10UniProtVAR_BLAB_PROVU_012 *V283ABLAB_PROVU  ---  ---A/BA280A
11UniProtVAR_BLAB_PROVU_013 *T286ABLAB_PROVU  ---  ---A/BA283A
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (11, 11)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_BLAB_PROVU_003 *S40NBLAB_PROVU  ---  ---AN34N
02UniProtVAR_BLAB_PROVU_004 *E58KBLAB_PROVU  ---  ---AE52K
03UniProtVAR_BLAB_PROVU_005 *E88ABLAB_PROVU  ---  ---AA83A
04UniProtVAR_BLAB_PROVU_006 *V119TBLAB_PROVU  ---  ---AT114T
05UniProtVAR_BLAB_PROVU_007 *S123TBLAB_PROVU  ---  ---AT118T
06UniProtVAR_BLAB_PROVU_008 *Q126EBLAB_PROVU  ---  ---AE121E
07UniProtVAR_BLAB_PROVU_009 *H224NBLAB_PROVU  ---  ---AN219N
08UniProtVAR_BLAB_PROVU_010 *I235VBLAB_PROVU  ---  ---AV230V
09UniProtVAR_BLAB_PROVU_011 *K257EBLAB_PROVU  ---  ---AE254E
10UniProtVAR_BLAB_PROVU_012 *V283ABLAB_PROVU  ---  ---AA280A
11UniProtVAR_BLAB_PROVU_013 *T286ABLAB_PROVU  ---  ---AA283A
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (11, 11)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_BLAB_PROVU_003 *S40NBLAB_PROVU  ---  ---BN34N
02UniProtVAR_BLAB_PROVU_004 *E58KBLAB_PROVU  ---  ---BE52K
03UniProtVAR_BLAB_PROVU_005 *E88ABLAB_PROVU  ---  ---BA83A
04UniProtVAR_BLAB_PROVU_006 *V119TBLAB_PROVU  ---  ---BT114T
05UniProtVAR_BLAB_PROVU_007 *S123TBLAB_PROVU  ---  ---BT118T
06UniProtVAR_BLAB_PROVU_008 *Q126EBLAB_PROVU  ---  ---BE121E
07UniProtVAR_BLAB_PROVU_009 *H224NBLAB_PROVU  ---  ---BN219N
08UniProtVAR_BLAB_PROVU_010 *I235VBLAB_PROVU  ---  ---BV230V
09UniProtVAR_BLAB_PROVU_011 *K257EBLAB_PROVU  ---  ---BE254E
10UniProtVAR_BLAB_PROVU_012 *V283ABLAB_PROVU  ---  ---BA280A
11UniProtVAR_BLAB_PROVU_013 *T286ABLAB_PROVU  ---  ---BA283A
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 2)

Asymmetric Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1BETA_LACTAMASE_APS00146 Beta-lactamase class-A active site.BLAB_PROVU71-86
 
  2A:66-81
B:66-81
Biological Unit 1 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1BETA_LACTAMASE_APS00146 Beta-lactamase class-A active site.BLAB_PROVU71-86
 
  1A:66-81
-
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1BETA_LACTAMASE_APS00146 Beta-lactamase class-A active site.BLAB_PROVU71-86
 
  1-
B:66-81

(-) Exons   (0, 0)

(no "Exon" information available for 1HZO)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:264
 aligned with BLAB_PROVU | P52664 from UniProtKB/Swiss-Prot  Length:300

    Alignment length:264
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292    
           BLAB_PROVU    33 NTIEEQLSTLEKYSQGRLGVALINTEDNSQITYRGEERFAMASTSKVMAVAAVLKESEKQAGLLDKNITIKKSDLVAYSPITEKHLVTGMSLAQLSAATLQYSDNTAMNKILDYLGGPAKVTQFARSINDVTYRLDRKEPELNTAIHGDPRDTTSPIAMAKSLQALTLGDALGQSQRQQLVTWLKGNTTGDHSIKAGLPKHWIVGDKTGSGDYGTTNDIAVIWPKNHAPLILVVYFTQQEQDAKYRKDIIVKATEIVTKEISNS 296
               SCOP domains d1hzoa_ A: beta-Lactamase, class A                                                                                                                                                                                                                                       SCOP domains
               CATH domains 1hzoA00 A:27-293 DD-peptidase/beta-lactamase superfamily                                                                                                                                                                                                                 CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhh.eeeeeeee....eeeee.....ee.hhhhhhhhhhhhhhhhhhh.hhhh.ee..hhhhh.....hhhhh....eehhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhh........eehhhhhhhhhhhhhh....hhhhhhhhhhhhhh......hhhhhh....eeeeeeeee...eeeeeeeee......eeeeeeee........hhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------N-----------------K-----------------------------A------------------------------T---T--E-------------------------------------------------------------------------------------------------N----------V---------------------E-------------------------A--A---------- SAPs(SNPs)
                    PROSITE --------------------------------------BETA_LACTAMASE_A------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1hzo A  27 NTIEEQLNTLEKYSQGRLGVALINTEDNSQITYRGEERFAMASTSKVMAVAAVLKASEKQAGLLDKNITIKKSDLVAYSPITEKHLTTGMTLAELSAATLQYSDNTAMNKILDYLGGPAKVTQFARSINDVTYRLDRKEPELNTAIHGDPRDTTSPIAMAKSLQALTLGDALGQSQRQQLVTWLKGNTTGDNSIKAGLPKHWVVGDKTGSGDYGTTNDIAVIWPENHAPLILVVYFTQQEQNAKYRKDIIAKAAEIVTKEISNS 293
                                    36        46        56||      67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237||     248   ||  259       269       279       289    
                                                         57|                                                                                                                                                                                238|         252|                                       
                                                          59                                                                                                                                                                                 240          254                                       

Chain B from PDB  Type:PROTEIN  Length:264
 aligned with BLAB_PROVU | P52664 from UniProtKB/Swiss-Prot  Length:300

    Alignment length:264
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292    
           BLAB_PROVU    33 NTIEEQLSTLEKYSQGRLGVALINTEDNSQITYRGEERFAMASTSKVMAVAAVLKESEKQAGLLDKNITIKKSDLVAYSPITEKHLVTGMSLAQLSAATLQYSDNTAMNKILDYLGGPAKVTQFARSINDVTYRLDRKEPELNTAIHGDPRDTTSPIAMAKSLQALTLGDALGQSQRQQLVTWLKGNTTGDHSIKAGLPKHWIVGDKTGSGDYGTTNDIAVIWPKNHAPLILVVYFTQQEQDAKYRKDIIVKATEIVTKEISNS 296
               SCOP domains d1hzob_ B: beta-Lactamase, class A                                                                                                                                                                                                                                       SCOP domains
               CATH domains 1hzoB00 B:27-293 DD-peptidase/beta-lactamase superfamily                                                                                                                                                                                                                 CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh.eeeeeeee.....eeee.....ee.hhhhhhhhhhhhhhhhh...hhhh.ee..hhhhh.....hhhhh....eehhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhh........eehhhhhhhhhhhhhh....hhhhhhhhhhhhhh......hhhhhh....eeeeeeeee...eeeeeeeee......eeeeeeee........hhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------N-----------------K-----------------------------A------------------------------T---T--E-------------------------------------------------------------------------------------------------N----------V---------------------E-------------------------A--A---------- SAPs(SNPs)
                    PROSITE --------------------------------------BETA_LACTAMASE_A------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1hzo B  27 NTIEEQLNTLEKYSQGRLGVALINTEDNSQITYRGEERFAMASTSKVMAVAAVLKASEKQAGLLDKNITIKKSDLVAYSPITEKHLTTGMTLAELSAATLQYSDNTAMNKILDYLGGPAKVTQFARSINDVTYRLDRKEPELNTAIHGDPRDTTSPIAMAKSLQALTLGDALGQSQRQQLVTWLKGNTTGDNSIKAGLPKHWVVGDKTGSGDYGTTNDIAVIWPENHAPLILVVYFTQQEQNAKYRKDIIAKAAEIVTKEISNS 293
                                    36        46        56||      67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237||     248   ||  259       269       279       289    
                                                         57|                                                                                                                                                                                238|         252|                                       
                                                          59                                                                                                                                                                                 240          254                                       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1HZO)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (BLAB_PROVU | P52664)
molecular function
    GO:0008800    beta-lactamase activity    Catalysis of the reaction: a beta-lactam + H2O = a substituted beta-amino acid.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
biological process
    GO:0030655    beta-lactam antibiotic catabolic process    The chemical reactions and pathways resulting in the breakdown of a beta-lactam antibiotic, any member of a class of natural or semisynthetic antibiotics whose characteristic feature is a strained, four-membered beta-lactam ring. They include the penicillins and many of the cephalosporins.
    GO:0046677    response to antibiotic    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an antibiotic stimulus. An antibiotic is a chemical substance produced by a microorganism which has the capacity to inhibit the growth of or to kill other microorganisms.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MES  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu A:166 - Pro A:167   [ RasMol ]  
    Glu B:166 - Pro B:167   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1hzo
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  BLAB_PROVU | P52664
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.5.2.6
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  BLAB_PROVU | P52664
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1HZO)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1HZO)