|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1HUE) |
(no "Site" information available for 1HUE) |
(no "SS Bond" information available for 1HUE) |
(no "Cis Peptide Bond" information available for 1HUE) |
(no "SAP(SNP)/Variant" information available for 1HUE) |
NMR Structure (1, 2)
|
(no "Exon" information available for 1HUE) |
NMR StructureChain A from PDB Type:PROTEIN Length:90 aligned with DBH_GEOSE | P0A3H0 from UniProtKB/Swiss-Prot Length:90 Alignment length:90 10 20 30 40 50 60 70 80 90 DBH_GEOSE 1 MNKTELINAVAETSGLSKKDATKAVDAVFDSITEALRKGDKVQLIGFGNFEVRERAARKGRNPQTGEEMEIPASKVPAFKPGKALKDAVK 90 SCOP domains d1huea_ A: HU protein SCOP domains CATH domains 1hueA00 A:1-90 HU Protein, subunit A CATH domains Pfam domains ------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ---------------------------------------------HISTONE_LIKE ------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------ Transcript 1hue A 1 MNKTELINAVAETSGLSKKDATKAVDAVFDSITEALRKGDKVQLIGFGNFEVRERAARKGRNPQTGEEMEIPASKVPAFKPGKALKDAVK 90 10 20 30 40 50 60 70 80 90 Chain B from PDB Type:PROTEIN Length:90 aligned with DBH_GEOSE | P0A3H0 from UniProtKB/Swiss-Prot Length:90 Alignment length:90 10 20 30 40 50 60 70 80 90 DBH_GEOSE 1 MNKTELINAVAETSGLSKKDATKAVDAVFDSITEALRKGDKVQLIGFGNFEVRERAARKGRNPQTGEEMEIPASKVPAFKPGKALKDAVK 90 SCOP domains d1hueb_ B: HU protein SCOP domains CATH domains 1hueB00 B:1-90 HU Protein, subunit A CATH domains Pfam domains ------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ---------------------------------------------HISTONE_LIKE ------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------ Transcript 1hue B 1 MNKTELINAVAETSGLSKKDATKAVDAVFDSITEALRKGDKVQLIGFGNFEVRERAARKGRNPQTGEEMEIPASKVPAFKPGKALKDAVK 90 10 20 30 40 50 60 70 80 90
|
NMR Structure
|
NMR Structure
|
(no "Pfam Domain" information available for 1HUE) |
NMR Structure(hide GO term definitions) Chain A,B (DBH_GEOSE | P0A3H0)
|
|
|
|
|
|
|