1HSS - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   0.19 ALPHA-AMYLASE INHIBITOR FROM WHEAT

Authors :   Y. Oda, K. Fukuyama

Date :   01 Jul 97 (Deposition) - 01 Jul 98 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.06

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)

Keywords :   Cereal Inhibitor, Animal Amylase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Oda, T. Matsunaga, K. Fukuyama, T. Miyazaki, T. Morimoto
Tertiary And Quaternary Structures Of 0. 19 Alpha-Amylase Inhibitor From Wheat Kernel Determined By X-Ray Analysis At 2. 06 A Resolution.
Biochemistry V. 36 13503 1997
PubMed-ID: 9354618 | Reference-DOI: 10.1021/BI971307M
(for further references see the PDB file header)

Molecule 1 - 0.19 ALPHA-AMYLASE INHIBITOR
	Chains	:	A, B, C, D
	Organ	:	KERNEL
	Organism Common	:	BREAD WHEAT
	Organism Scientific	:	TRITICUM AESTIVUM
	Organism Taxid	:	4565

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1HSS)

(no "Site" information available for 1HSS)

Asymmetric Unit

No.	Residues
1	A:6	-	A:52
2	A:20	-	A:41
3	A:28	-	A:83
4	A:42	-	A:99
5	A:54	-	A:115
6	B:6	-	B:52
7	B:20	-	B:41
8	B:28	-	B:83
9	B:42	-	B:99
10	B:54	-	B:115
11	C:6	-	C:52
12	C:20	-	C:41
13	C:28	-	C:83
14	C:42	-	C:99
15	C:54	-	C:115
16	D:6	-	D:52
17	D:20	-	D:41
18	D:28	-	D:83
19	D:42	-	D:99
20	D:54	-	D:115

Asymmetric Unit

No.	Residues
1	Val A:14	-	Pro A:15
2	Tyr A:121	-	Pro A:122
3	Val B:14	-	Pro B:15
4	Tyr B:121	-	Pro B:122
5	Val C:14	-	Pro C:15
6	Tyr C:121	-	Pro C:122
7	Val D:14	-	Pro D:15
8	Tyr D:121	-	Pro D:122

(no "SAP(SNP)/Variant" information available for 1HSS)

Asymmetric Unit (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CEREAL_TRYP_AMYL_INH	PS00426	Cereal trypsin/alpha-amylase inhibitors family signature.	IAA1_WHEAT	6-28	4	A:6-28 B:6-28 C:6-28 D:6-28

Biological Unit 1 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CEREAL_TRYP_AMYL_INH	PS00426	Cereal trypsin/alpha-amylase inhibitors family signature.	IAA1_WHEAT	6-28	2	A:6-28 B:6-28 - -

Biological Unit 2 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CEREAL_TRYP_AMYL_INH	PS00426	Cereal trypsin/alpha-amylase inhibitors family signature.	IAA1_WHEAT	6-28	2	- - C:6-28 D:6-28

(no "Exon" information available for 1HSS)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:111
 aligned with IAA1_WHEAT | P01085 from UniProtKB/Swiss-Prot  Length:124

    Alignment length:120
                                    14        24        34        44        54        64        74        84        94       104       114       124
           IAA1_WHEAT     5 MCYPGQAFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQLAHISEWCRCGALYSMLDSMYKEHGAQEGQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAAYPDA 124
               SCOP domains d1hssa_ A: 0.19 alpha-amylase inhibitor                                                                                  SCOP domains
               CATH domains 1hssA00 A:5-124 Bifunctional Trypsin/Alpha-Amylase Inhibitor                                                             CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...............hhhhhhhh.......hhhhhhhhhhhh......hhhhhhhhhhhhhh..---------.......hhhhhhhhh.hhhhh...ee......ee...hhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -CEREAL_TRYP_AMYL_INH   ------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------ Transcript
                 1hss A   5 MCYPGQAFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQLAHISEWCRCGALYSMLDSMYKEH---------GAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAAYPDA 124
                                    14        24        34        44        54        64   |     -   |    84        94       104       114       124
                                                                                          68        78

Chain B from PDB  Type:PROTEIN  Length:111
 aligned with IAA1_WHEAT | P01085 from UniProtKB/Swiss-Prot  Length:124

    Alignment length:120
                                    14        24        34        44        54        64        74        84        94       104       114       124
           IAA1_WHEAT     5 MCYPGQAFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQLAHISEWCRCGALYSMLDSMYKEHGAQEGQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAAYPDA 124
               SCOP domains d1hssb_ B: 0.19 alpha-amylase inhibitor                                                                                  SCOP domains
               CATH domains 1hssB00 B:5-124 Bifunctional Trypsin/Alpha-Amylase Inhibitor                                                             CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...............hhhhhhhh.......hhhhhhhhhhhh......hhhhhhhhhhhhhh..---------.......hhhhhhhhh.hhhhh...ee......ee...hhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -CEREAL_TRYP_AMYL_INH   ------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------ Transcript
                 1hss B   5 MCYPGQAFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQLAHISEWCRCGALYSMLDSMYKEH---------GAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAAYPDA 124
                                    14        24        34        44        54        64   |     -   |    84        94       104       114       124
                                                                                          68        78

Chain C from PDB  Type:PROTEIN  Length:111
 aligned with IAA1_WHEAT | P01085 from UniProtKB/Swiss-Prot  Length:124

    Alignment length:120
                                    14        24        34        44        54        64        74        84        94       104       114       124
           IAA1_WHEAT     5 MCYPGQAFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQLAHISEWCRCGALYSMLDSMYKEHGAQEGQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAAYPDA 124
               SCOP domains d1hssc_ C: 0.19 alpha-amylase inhibitor                                                                                  SCOP domains
               CATH domains 1hssC00 C:5-124 Bifunctional Trypsin/Alpha-Amylase Inhibitor                                                             CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...............hhhhhhhh.......hhhhhhhhhhhh......hhhhhhhhhhhhhh..---------.......hhhhhhhhh.hhhhh...ee......ee...hhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -CEREAL_TRYP_AMYL_INH   ------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------ Transcript
                 1hss C   5 MCYPGQAFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQLAHISEWCRCGALYSMLDSMYKEH---------GAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAAYPDA 124
                                    14        24        34        44        54        64   |     -   |    84        94       104       114       124
                                                                                          68        78

Chain D from PDB  Type:PROTEIN  Length:111
 aligned with IAA1_WHEAT | P01085 from UniProtKB/Swiss-Prot  Length:124

    Alignment length:120
                                    14        24        34        44        54        64        74        84        94       104       114       124
           IAA1_WHEAT     5 MCYPGQAFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQLAHISEWCRCGALYSMLDSMYKEHGAQEGQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAAYPDA 124
               SCOP domains d1hssd_ D: 0.19 alpha-amylase inhibitor                                                                                  SCOP domains
               CATH domains 1hssD00 D:5-124 Bifunctional Trypsin/Alpha-Amylase Inhibitor                                                             CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...............hhhhhhhh.......hhhhhhhhhhhh......hhhhhhhhhhhhhh..---------.......hhhhhhhhh.hhhhh...ee......ee...hhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -CEREAL_TRYP_AMYL_INH   ------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------ Transcript
                 1hss D   5 MCYPGQAFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQLAHISEWCRCGALYSMLDSMYKEH---------GAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAAYPDA 124
                                    14        24        34        44        54        64   |     -   |    84        94       104       114       124
                                                                                          68        78

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Bifunctional Trypsin/Alpha-Amylase Inhibitor (8)

Homologous Superfamily: Bifunctional Trypsin/Alpha-Amylase Inhibitor (8)

Bread wheat (Triticum aestivum) (1)

1a	1hssA00	A:5-124
1b	1hssB00	B:5-124
1c	1hssC00	C:5-124
1d	1hssD00	D:5-124

(no "Pfam Domain" information available for 1HSS)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (IAA1_WHEAT | P01085)

molecular function
	GO:0015066	alpha-amylase inhibitor activity	Stops, prevents or reduces the activity of alpha-amylase.
	GO:0004867	serine-type endopeptidase inhibitor activity	Stops, prevents or reduces the activity of serine-type endopeptidases, enzymes that catalyze the hydrolysis of nonterminal peptide bonds in a polypeptide chain; a serine residue (and a histidine residue) are at the active center of the enzyme.
biological process
	GO:0043086	negative regulation of catalytic activity	Any process that stops or reduces the activity of an enzyme.
	GO:0010951	negative regulation of endopeptidase activity	Any process that decreases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1hss)

	Sites
(no "Sites" information available for 1hss)

	Cis Peptide Bonds
		Tyr A:121 - Pro A:122	[ RasMol ]
		Tyr B:121 - Pro B:122	[ RasMol ]
		Tyr C:121 - Pro C:122	[ RasMol ]
		Tyr D:121 - Pro D:122	[ RasMol ]
		Val A:14 - Pro A:15	[ RasMol ]
		Val B:14 - Pro B:15	[ RasMol ]
		Val C:14 - Pro C:15	[ RasMol ]
		Val D:14 - Pro D:15	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1hss
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	IAA1_WHEAT \| P01085
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	IAA1_WHEAT \| P01085
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 1HSS)

(no "Related Entries Specified in the PDB File" available for 1HSS)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (20, 20)

Cis Peptide Bonds (8, 8)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 4)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (0, 0)

Gene Ontology (6, 6)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File