Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  MOLECULAR STRUCTURE OF A HIGH POTENTIAL CYTOCHROME C2 ISOLATED FROM RHODOPILA GLOBIFORMIS
 
Authors :  M. M. Benning, T. E. Meyer, H. M. Holden
Date :  10 Jul 96  (Deposition) - 11 Jan 97  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Electron Transport, Photosynthesis, Heme (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. M. Benning, T. E. Meyer, H. M. Holden
Molecular Structure Of A High Potential Cytochrome C2 Isolated From Rhodopila Globiformis.
Arch. Biochem. Biophys. V. 333 338 1996
PubMed-ID: 8809072  |  Reference-DOI: 10.1006/ABBI.1996.0400
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CYTOCHROME C2
    ChainsA, B
    Organism ScientificRHODOPILA GLOBIFORMIS
    Organism Taxid1071

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1HEM2Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1HEM1Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1HEM1Ligand/IonPROTOPORPHYRIN IX CONTAINING FE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARECYS A:19 , CYS A:22 , HIS A:23 , VAL A:32 , LEU A:36 , ARG A:42 , SER A:44 , GLY A:45 , TYR A:50 , TYR A:52 , SER A:53 , ASN A:56 , TRP A:63 , LEU A:68 , TYR A:71 , ILE A:72 , THR A:82 , LYS A:83 , MET A:84 , HOH A:111BINDING SITE FOR RESIDUE HEM A 107
2AC2SOFTWAREILE B:18 , CYS B:19 , CYS B:22 , HIS B:23 , VAL B:32 , ARG B:42 , SER B:44 , GLY B:45 , TYR B:50 , TYR B:52 , SER B:53 , ASN B:56 , TRP B:63 , LEU B:68 , TYR B:71 , ILE B:72 , THR B:82 , LYS B:83 , MET B:84 , TYR B:86 , HOH B:113 , HOH B:137BINDING SITE FOR RESIDUE HEM B 107

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1HRO)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1HRO)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1HRO)

(-) PROSITE Motifs  (1, 2)

Asymmetric Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CYTCPS51007 Cytochrome c family profile.CYC2_RHOGL6-106
 
  2A:6-106
B:6-106
Biological Unit 1 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CYTCPS51007 Cytochrome c family profile.CYC2_RHOGL6-106
 
  1A:6-106
-
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CYTCPS51007 Cytochrome c family profile.CYC2_RHOGL6-106
 
  1-
B:6-106

(-) Exons   (0, 0)

(no "Exon" information available for 1HRO)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:105
 aligned with CYC2_RHOGL | P00080 from UniProtKB/Swiss-Prot  Length:106

    Alignment length:105
                                    11        21        31        41        51        61        71        81        91       101     
           CYC2_RHOGL     2 SAPPGDPVEGKHLFHTICILCHTDIKGRNKVGPSLYGVVGRHSGIEPGYNYSEANIKSGIVWTPDVLFKYIEHPQKIVPGTKMGYPGQPDPQKRADIIAYLETLK 106
               SCOP domains d1hroa_ A: Cytochrome c2                                                                                  SCOP domains
               CATH domains 1hroA00 A:2-106 Cytochrome c                                                                              CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhh...hhh................................hhhhhh.....hhhhhhhhh.hhhh.............hhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----CYTC  PDB: A:6-106 UniProt: 6-106                                                                     PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------- Transcript
                 1hro A   2 SAPPGDPVEGKHLFHTICITCHTDIKGANKVGPSLYGVVGRHSGIEPGYNYSEANIKSGIVWTPDVLFKYIEHPQKIVPGTKMGYPGQPDPQKRADIIAYLETLK 106
                                    11        21        31        41        51        61        71        81        91       101     

Chain B from PDB  Type:PROTEIN  Length:105
 aligned with CYC2_RHOGL | P00080 from UniProtKB/Swiss-Prot  Length:106

    Alignment length:105
                                    11        21        31        41        51        61        71        81        91       101     
           CYC2_RHOGL     2 SAPPGDPVEGKHLFHTICILCHTDIKGRNKVGPSLYGVVGRHSGIEPGYNYSEANIKSGIVWTPDVLFKYIEHPQKIVPGTKMGYPGQPDPQKRADIIAYLETLK 106
               SCOP domains d1hrob_ B: Cytochrome c2                                                                                  SCOP domains
               CATH domains 1hroB00 B:2-106 Cytochrome c                                                                              CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhh.hhh................................hhhhhh.....hhhhhhhhh.hhhh.............hhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----CYTC  PDB: B:6-106 UniProt: 6-106                                                                     PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------- Transcript
                 1hro B   2 SAPPGDPVEGKHLFHTICITCHTDIKGANKVGPSLYGVVGRHSGIEPGYNYSEANIKSGIVWTPDVLFKYIEHPQKIVPGTKMGYPGQPDPQKRADIIAYLETLK 106
                                    11        21        31        41        51        61        71        81        91       101     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1HRO)

(-) Gene Ontology  (5, 5)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (CYC2_RHOGL | P00080)
molecular function
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    HEM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1hro)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1hro
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CYC2_RHOGL | P00080
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CYC2_RHOGL | P00080
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1HRO)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1HRO)