|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 2)
|
Asymmetric Unit (2, 2)
|
(no "SS Bond" information available for 1HRO) |
(no "Cis Peptide Bond" information available for 1HRO) |
(no "SAP(SNP)/Variant" information available for 1HRO) |
Asymmetric Unit (1, 2)
|
(no "Exon" information available for 1HRO) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:105 aligned with CYC2_RHOGL | P00080 from UniProtKB/Swiss-Prot Length:106 Alignment length:105 11 21 31 41 51 61 71 81 91 101 CYC2_RHOGL 2 SAPPGDPVEGKHLFHTICILCHTDIKGRNKVGPSLYGVVGRHSGIEPGYNYSEANIKSGIVWTPDVLFKYIEHPQKIVPGTKMGYPGQPDPQKRADIIAYLETLK 106 SCOP domains d1hroa_ A: Cytochrome c2 SCOP domains CATH domains 1hroA00 A:2-106 Cytochrome c CATH domains Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----CYTC PDB: A:6-106 UniProt: 6-106 PROSITE Transcript --------------------------------------------------------------------------------------------------------- Transcript 1hro A 2 SAPPGDPVEGKHLFHTICITCHTDIKGANKVGPSLYGVVGRHSGIEPGYNYSEANIKSGIVWTPDVLFKYIEHPQKIVPGTKMGYPGQPDPQKRADIIAYLETLK 106 11 21 31 41 51 61 71 81 91 101 Chain B from PDB Type:PROTEIN Length:105 aligned with CYC2_RHOGL | P00080 from UniProtKB/Swiss-Prot Length:106 Alignment length:105 11 21 31 41 51 61 71 81 91 101 CYC2_RHOGL 2 SAPPGDPVEGKHLFHTICILCHTDIKGRNKVGPSLYGVVGRHSGIEPGYNYSEANIKSGIVWTPDVLFKYIEHPQKIVPGTKMGYPGQPDPQKRADIIAYLETLK 106 SCOP domains d1hrob_ B: Cytochrome c2 SCOP domains CATH domains 1hroB00 B:2-106 Cytochrome c CATH domains Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----CYTC PDB: B:6-106 UniProt: 6-106 PROSITE Transcript --------------------------------------------------------------------------------------------------------- Transcript 1hro B 2 SAPPGDPVEGKHLFHTICITCHTDIKGANKVGPSLYGVVGRHSGIEPGYNYSEANIKSGIVWTPDVLFKYIEHPQKIVPGTKMGYPGQPDPQKRADIIAYLETLK 106 11 21 31 41 51 61 71 81 91 101
|
Asymmetric Unit
|
Asymmetric Unit |
(no "Pfam Domain" information available for 1HRO) |
Asymmetric Unit(hide GO term definitions) Chain A,B (CYC2_RHOGL | P00080)
|
|
|
|
|
|
|