Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  TERTIARY STRUCTURE OF APO-D-ALANYL CARRIER PROTEIN
 
Authors :  B. F. Volkman, Q. Zhang, D. V. Debabov, E. Rivera, G. Kresheck, F. C. Neuhaus
Date :  14 Dec 00  (Deposition) - 01 Aug 01  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A
Keywords :  3-Helix Bundle, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  B. F. Volkman, Q. Zhang, D. V. Debabov, E. Rivera, G. C. Kresheck, F. C. Neuhaus
Biosynthesis Of D-Alanyl-Lipoteichoic Acid: The Tertiary Structure Of Apo-D-Alanyl Carrier Protein.
Biochemistry V. 40 7964 2001
PubMed-ID: 11434765  |  Reference-DOI: 10.1021/BI010355A
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - APO-D-ALANYL CARRIER PROTEIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PDCP1
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: RESIDUES 2-81
    Gene: DLTC
    Organism Scientific: LACTOBACILLUS CASEI
    Organism Taxid: 1582
    Synonym: APO-DCP

 Structural Features

(-) Chains, Units

  
NMR Structure : 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1HQB)

(-) Sites  (0, 0)

(no "Site" information available for 1HQB)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1HQB)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1HQB)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1HQB)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1HQB)

(-) Exons   (0, 0)

(no "Exon" information available for 1HQB)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:80
 aligned with DLTC_LACP3 | Q03AZ0 from UniProtKB/Swiss-Prot  Length:81

    Alignment length:80
                                    11        21        31        41        51        61        71        81
            DLTC_LACP3    2 ADEAIKNGVLDILADLTGSDDVKTNLDLNLFETGLLDSMGTVQLLLELQSQFGVEAPVSEFDRSQWDTPNKIIAKVEQAQ 81
               SCOP domains d1hqba_ A: apo-D-alanyl carrier protein                                          SCOP domains
               CATH domains 1hqbA00 A:2-81  [code=1.10.1200.10, no name defined]                             CATH domains
               Pfam domains -------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhh...................hhhhhhhhhhhh..................hhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------- Transcript
                  1hqb A  2 ADEAIKNGVLDILADLTGSDDVKKNLDLNLFETGLLDSMGTVQLLLELQSQFGVDAPVSEFDRKEWDTPNKIIAKVEQAQ 81
                                    11        21        31        41        51        61        71        81


Chain A from PDB  Type:PROTEIN  Length:80
 aligned with DLTC_LACRH | P55153 from UniProtKB/Swiss-Prot  Length:81

    Alignment length:80
                                    11        21        31        41        51        61        71        81
            DLTC_LACRH    2 ADEAIKNGVLDILADLTGSDDVKKNLDLNLFETGLLDSMGTVQLLLELQSQFGVDAPVSEFDRKEWDTPNKIIAKVEQAQ 81
               SCOP domains d1hqba_ A: apo-D-alanyl carrier protein                                          SCOP domains
               CATH domains 1hqbA00 A:2-81  [code=1.10.1200.10, no name defined]                             CATH domains
               Pfam domains -------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhh...................hhhhhhhhhhhh..................hhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------- Transcript
                  1hqb A  2 ADEAIKNGVLDILADLTGSDDVKKNLDLNLFETGLLDSMGTVQLLLELQSQFGVDAPVSEFDRKEWDTPNKIIAKVEQAQ 81
                                    11        21        31        41        51        61        71        81
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1HQB)

(-) Gene Ontology  (10, 19)

NMR Structure(hide GO term definitions)
Chain A   (DLTC_LACP3 | Q03AZ0)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0047473    D-alanine-poly(phosphoribitol) ligase activity    Catalysis of the reaction: poly(ribitol phosphate) + D-alanine + ATP = O-D-alanyl-poly(ribitol phosphate) + diphosphate + AMP.
    GO:0036370    D-alanyl carrier activity    Accepts activated D-alanine and subsequently transfers D-alanine onto a teichoic acid acceptor molecule. The carrier protein provides an essential link between the D-alanine-D-alanyl carrier protein ligase and the incorporation of D-alanine into the substrate.
    GO:0016874    ligase activity    Catalysis of the joining of two substances, or two groups within a single molecule, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
    GO:0071555    cell wall organization    A process that results in the assembly, arrangement of constituent parts, or disassembly of the cell wall, the rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal and most prokaryotic cells, maintaining their shape and protecting them from osmotic lysis.
    GO:0070395    lipoteichoic acid biosynthetic process    The chemical reactions and pathways resulting in the formation of lipoteichoic acid, which is a major component of the cell wall of gram-positive bacteria and typically consists of a chain of glycerol-phosphate repeating units linked to a glycolipid anchor.
    GO:0008360    regulation of cell shape    Any process that modulates the surface configuration of a cell.
    GO:0070400    teichoic acid D-alanylation    The formation of a D-alanyl ester of teichoic acid. Alanylation of teichoic acids modulates the properties of the bacterial cell wall and modulates the inflammatory properties of the teichoic acid.
    GO:0019350    teichoic acid biosynthetic process    The chemical reactions and pathways resulting in the formation of teichoic acid, any polymer occurring in the cell wall, membrane or capsule of Gram-positive bacteria and containing chains of glycerol phosphate or ribitol phosphate residues.

Chain A   (DLTC_LACRH | P55153)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0047473    D-alanine-poly(phosphoribitol) ligase activity    Catalysis of the reaction: poly(ribitol phosphate) + D-alanine + ATP = O-D-alanyl-poly(ribitol phosphate) + diphosphate + AMP.
    GO:0036370    D-alanyl carrier activity    Accepts activated D-alanine and subsequently transfers D-alanine onto a teichoic acid acceptor molecule. The carrier protein provides an essential link between the D-alanine-D-alanyl carrier protein ligase and the incorporation of D-alanine into the substrate.
    GO:0016874    ligase activity    Catalysis of the joining of two substances, or two groups within a single molecule, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
    GO:0071555    cell wall organization    A process that results in the assembly, arrangement of constituent parts, or disassembly of the cell wall, the rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal and most prokaryotic cells, maintaining their shape and protecting them from osmotic lysis.
    GO:0070395    lipoteichoic acid biosynthetic process    The chemical reactions and pathways resulting in the formation of lipoteichoic acid, which is a major component of the cell wall of gram-positive bacteria and typically consists of a chain of glycerol-phosphate repeating units linked to a glycolipid anchor.
    GO:0070400    teichoic acid D-alanylation    The formation of a D-alanyl ester of teichoic acid. Alanylation of teichoic acids modulates the properties of the bacterial cell wall and modulates the inflammatory properties of the teichoic acid.
    GO:0019350    teichoic acid biosynthetic process    The chemical reactions and pathways resulting in the formation of teichoic acid, any polymer occurring in the cell wall, membrane or capsule of Gram-positive bacteria and containing chains of glycerol phosphate or ribitol phosphate residues.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1hqb)
 
  Sites
(no "Sites" information available for 1hqb)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1hqb)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1hqb
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  DLTC_LACP3 | Q03AZ0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  DLTC_LACRH | P55153
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  DLTC_LACP3 | Q03AZ0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  DLTC_LACRH | P55153
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        DLTC_LACRH | P55153: 1dv5

(-) Related Entries Specified in the PDB File

1acp FAS ACYL CARRIER PROTEIN FROM E. COLI.