|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1HP8) |
Sites (0, 0)| (no "Site" information available for 1HP8) |
SS Bonds (3, 3)
NMR Structure
|
||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1HP8) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1HP8) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (2, 2)
NMR Structure (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:68 aligned with CMC4_HUMAN | P56277 from UniProtKB/Swiss-Prot Length:68 Alignment length:68 10 20 30 40 50 60 CMC4_HUMAN 1 MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK 68 SCOP domains d1hp8a_ A: p8-MTCP1 SCOP domains CATH domains 1hp8A00 A:1-68 Cysteine Motif CATH domains Pfam domains -------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs) PROSITE ---CHCH PDB: A:4-46 UniProt: 4-46 ---------------------- PROSITE Transcript 1 (1) Exon 1.4 PDB: A:1-2------------------------------------------------ Transcript 1 (1) Transcript 1 (2) -------------------Exon 1.5b PDB: A:20-68 UniProt: 20-68 Transcript 1 (2) 1hp8 A 1 MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK 68 10 20 30 40 50 60
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1HP8) |
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (CMC4_HUMAN | P56277)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|