1HJQ - JenaLib

Title :   STRUCTURE OF TWO FUNGAL BETA-1,4-GALACTANASES: SEARCHING FOR THE BASIS FOR TEMPERATURE AND PH OPTIMUM.

Authors :   J. Le Nours, C. Ryttersgaard, L. Lo Leggio, P. R. Ostergaard, T. V. Borchert, L. L. H. Christensen, S. Larsen

Date :   27 Feb 03 (Deposition) - 25 Jul 03 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.55

Chains :   Asym./Biol. Unit : A

Keywords :   Hydrolase, Beta-1, 4-Galactanases, Family 53 Glycoside Hydrolase, Thermostability, Ph Optimum, Clan Gh-A, Thermophile, Alkalophile (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Le Nours, C. Ryttersgaard, L. Lo Leggio, P. R. Ostergaard, T. V. Borchert, L. L. H. Christensen, S. Larsen
Structure Of Two Fungal Beta-1, 4-Galactanases: Searching For The Basis For Temperature And Ph Optimum
Protein Sci. V. 12 1195 2003
PubMed-ID: 12761390 | Reference-DOI: 10.1110/PS.0300103

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (1, 1)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:332
 aligned with GANA_HUMIN | P83691 from UniProtKB/Swiss-Prot  Length:332

    Alignment length:332
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330  
           GANA_HUMIN     1 ALQYKGVDWSSVMVEERAGVRYKNVNGQEKPLEYILAENGVNMVRQRVWVNPWDGNYNLDYNIQLARRAKAAGLGLYINFHYSDTWADPAHQTTPAGWPSDINNLAWKLYNYTLDSMNRFADAGIQVDIVSIGNEITQGLLWPLGKTNNWYNIARLLHSAAWGVKDSRLNPKPKIMVHLDNGWNWDTQNWWYTNVLSQGPFEMSDFDMMGVSFYPFYSASATLDSLRRSLNNMVSRWGKEVAVVETNWPTSCPYPRYQFPADVRNVPFSAAGQTQYIQSVANVVSSVSKGVGLFYWEPAWIHNANLGSSCADNTMFTPSGQALSSLSVFHRI 332
               SCOP domains d1hjqa_ A: Beta-1,4-galactanase                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1hjqA00 A:1-332 Glycosidases                                                                                                                                                                                                                                                                                                                 CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..hhhhhhhh............hhhhhhhhh...eeeeee.........hhhhhhhhhhhhhhh..eeeeee....................hhhhhhhhhhhhhhhhhhhhhhhh....eeee................hhhhhhhhhhhhhhhhhh.......eeeeee....hhhhhhhhhhhhhhhh..hhhhh.eeeee.........hhhhhhhhhhhhhhhhh.eeeeee..............hhhhh....hhhhhhhhhhhhhhhhhhh..eeeeeee...hhhhh..................hhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1hjq A   1 ALQYKGVDWSSVMVEERAGVRYKNVNGQEKPLEYILAENGVNMVRQRVWVNPWDGNYNLDYNIQLARRAKAAGLGLYINFHYSDTWADPAHQTTPAGWPSDINNLAWKLYNYTLDSMNRFADAGIQVDIVSIGNEITQGLLWPLGKTNNWYNIARLLHSAAWGVKDSRLNPKPKIMVHLDNGWNWDTQNWWYTNVLSQGPFEMSDFDMMGVSFYPFYSASATLDSLRRSLNNMVSRWGKEVAVVETNWPTSCPYPRYQFPADVRNVPFSAAGQTQYIQSVANVVSSVSKGVGLFYWEPAWIHNANLGSSCADNTMFTPSGQALSSLSVFHRI 332
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (10, 10)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (GANA_HUMIN | P83691)

molecular function
	GO:0031218	arabinogalactan endo-1,4-beta-galactosidase activity	Catalysis of the endohydrolysis of (1->4)-beta-D-galactosidic linkages in arabinogalactans.
	GO:0015926	glucosidase activity	Catalysis of the hydrolysis of glucosyl compounds, substances containing a group derived from a cyclic form of glucose or a glucose derivative.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0016798	hydrolase activity, acting on glycosyl bonds	Catalysis of the hydrolysis of any glycosyl bond.
	GO:0004553	hydrolase activity, hydrolyzing O-glycosyl compounds	Catalysis of the hydrolysis of any O-glycosyl bond.
	GO:0030247	polysaccharide binding	Interacting selectively and non-covalently with any polysaccharide, a polymer of many (typically more than 10) monosaccharide residues linked glycosidically.
biological process
	GO:0005975	carbohydrate metabolic process	The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
	GO:0016998	cell wall macromolecule catabolic process	The chemical reactions and pathways resulting in the breakdown of macromolecules that form part of a cell wall.
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
cellular component
	GO:0043245	extraorganismal space	The environmental space outside of an organism; this may be a host organism in the case of parasitic and symbiotic organisms.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		NAG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Asn A:170 - Pro A:171	[ RasMol ]
		Trp A:142 - Pro A:143	[ RasMol ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1hjq
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GANA_HUMIN \| P83691
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.2.1.89
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description