|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1HH0) |
Sites (0, 0)| (no "Site" information available for 1HH0) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1HH0) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1HH0) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1HH0) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1HH0) |
Exons (0, 0)| (no "Exon" information available for 1HH0) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:46 aligned with CAPSD_BPH75 | P82889 from UniProtKB/Swiss-Prot Length:46 Alignment length:46 10 20 30 40 CAPSD_BPH75 1 MDFNPSEVASQVTNYIQAIAAAGVGVLALAIGLSAAWKYAKRFLKG 46 SCOP domains d1hh0a_ A: SCOP domains CATH domains 1hh0A00 A:1-46 CATH domains Pfam domains ---------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------- PROSITE Transcript ---------------------------------------------- Transcript 1hh0 A 1 MDFNPSEVASQVTNYIQAIAAAGVGVLALAIGLSAAWKYAKRFLKG 46 10 20 30 40
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1HH0) |
Gene Ontology (6, 6)|
Asymmetric Unit(hide GO term definitions) Chain A (CAPSD_BPH75 | P82889)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|