1HGX - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   HYPOXANTHINE-GUANINE-XANTHINE PHOSPHORIBOSYLTRANSFERASE (HGXPRTASE)

Authors :   J. R. Somoza, C. C. Wang, R. J. Fletterick

Date :   12 Mar 96 (Deposition) - 17 Aug 96 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym./Biol. Unit : A,B

Keywords :   Transferase, Glycosyltransferase, Purine Salvage, Transferase (Glycosyltransferase) (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. R. Somoza, M. S. Chin, P. J. Focia, C. C. Wang, R. J. Fletterick
Crystal Structure Of The Hypoxanthine-Guanine-Xanthine Phosphoribosyltransferase From The Protozoan Parasite Tritrichomonas Foetus.
Biochemistry V. 35 7032 1996
PubMed-ID: 8679528 | Reference-DOI: 10.1021/BI953072P
(for further references see the PDB file header)

Molecule 1 - HYPOXANTHINE-GUANINE-XANTHINE PHOSPHORIBOSYLTRANSFERASE
	Atcc	:	30924
	Chains	:	A, B
	EC Number	:	2.4.2.8
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PBACE
	Expression System Taxid	:	562
	Organism Scientific	:	TRITRICHOMONAS FOETUS
	Organism Taxid	:	5724
	Strain	:	KV1
	Synonym	:	HGXPRTASE

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (2, 2)

No.	Name	Count	Type	Full Name
1	5GP	1	Ligand/Ion	GUANOSINE-5'-MONOPHOSPHATE
2	SO4	1	Ligand/Ion	SULFATE ION

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASP B:106 , THR B:107 , GLY B:108 , LEU B:109 , THR B:110 , HOH B:451	BINDING SITE FOR RESIDUE SO4 B 700
2	AC2	SOFTWARE	ASP A:103 , ILE A:104 , ASP A:106 , THR A:107 , GLY A:108 , LEU A:109 , THR A:110 , LYS A:134 , ARG A:155 , TYR A:156 , ILE A:157 , ASP A:163 , HOH A:413 , HOH A:414 , HOH A:418 , HOH A:422 , HOH A:464	BINDING SITE FOR RESIDUE 5GP A 600

(no "SS Bond" information available for 1HGX)

Asymmetric/Biological Unit

No.	Residues
1	Leu A:46	-	Thr A:47
2	Leu B:46	-	Thr B:47

(no "SAP(SNP)/Variant" information available for 1HGX)

Asymmetric/Biological Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PUR_PYR_PR_TRANSFER	PS00103	Purine/pyrimidine phosphoribosyl transferases signature.	HGXR_TRIFO	98-110	2	A:98-110 B:98-110

(no "Exon" information available for 1HGX)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:164
 aligned with HGXR_TRIFO | P51900 from UniProtKB/Swiss-Prot  Length:183

    Alignment length:173
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176   
           HGXR_TRIFO     7 MDDLERVLYNQDDIQKRIRELAAELTEFYEDKNPVMICVLTGAVFFYTDLLKHLDFQLEPDYIICSSYSGTKSTGNLTISKDLKTNIEGRHVLVVEDIIDTGLTMYQLLNNLQMRKPASLKVCTLCDKDIGKKAYDVPIDYCGFVVENRYIIGYGFDFHNKYRNLPVIGILKE 179
               SCOP domains d1hgxa_ A: Hypoxanthine-guanine-xanthine PRTase                                                                                                                               SCOP domains
               CATH domains 1hgxA00 A:7-179  [code=3.40.50.2020, no name defined]                                                                                                                         CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee...hhhhhhhhhhhhhhhhhhh.....eeeee..hhhhhhhhhhhh.....eeeeeeee.---------.eeee.........eeeeee......hhhhhhhhhhhhh...eeeeee.eee...............eee......................eee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------PUR_PYR_PR_TR--------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1hgx A   7 MDDLERVLYNQDDIQKRIRELAAELTEFYEDKNPVMICVLTGAVFFYTDLLKHLDFQLEPDYIICSS---------LTISKDLKTNIEGRHVLVVEDIIDTGLTMYQLLNNLQMRKPASLKVCTLCDKDIGKKAYDVPIDYCGFVVENRYIIGYGFDFHNKYRNLPVIGILKE 179
                                    16        26        36        46        56        66      |  -      | 86        96       106       116       126       136       146       156       166       176   
                                                                                             73        83

Chain B from PDB  Type:PROTEIN  Length:164
 aligned with HGXR_TRIFO | P51900 from UniProtKB/Swiss-Prot  Length:183

    Alignment length:177
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       
           HGXR_TRIFO     7 MDDLERVLYNQDDIQKRIRELAAELTEFYEDKNPVMICVLTGAVFFYTDLLKHLDFQLEPDYIICSSYSGTKSTGNLTISKDLKTNIEGRHVLVVEDIIDTGLTMYQLLNNLQMRKPASLKVCTLCDKDIGKKAYDVPIDYCGFVVENRYIIGYGFDFHNKYRNLPVIGILKESVYT 183
               SCOP domains d1hgxb_ B: Hypoxanthine-guanine-xanthine PRTase                                                                                                                                   SCOP domains
               CATH domains 1hgxB00 B:7-183  [code=3.40.50.2020, no name defined]                                                                                                                             CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee...hhhhhhhhhhhhhhhhhhh.....eeeee..hhhhhhhhhhhh.....eeeee..-------------............eeeeee......hhhhhhhhhhhhh...eeeeee.eee...............eee......................eee.hhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------PUR_PYR_PR_TR------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1hgx B   7 MDDLERVLYNQDDIQKRIRELAAELTEFYEDKNPVMICVLTGAVFFYTDLLKHLDFQLEPDYIIC-------------ISKDLKTNIEGRHVLVVEDIIDTGLTMYQLLNNLQMRKPASLKVCTLCDKDIGKKAYDVPIDYCGFVVENRYIIGYGFDFHNKYRNLPVIGILKESVYT 183
                                    16        26        36        46        56        66    |    -        86        96       106       116       126       136       146       156       166       176       
                                                                                           71            85

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: PRTase-like (145)

Superfamily: PRTase-like (145)

Family: Phosphoribosyltransferases (PRTases) (100)

Protein domain: Hypoxanthine-guanine-xanthine PRTase (7)

Tritrichomonas foetus [TaxId: 5724] (1)

1a	d1hgxa_	A:
1b	d1hgxb_	B:

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: [code=3.40.50.2020, no name defined] (117)

Tritrichomonas foetus. Organism_taxid: 5724. Strain: kv1. (1)

1a	1hgxA00	A:7-179
1b	1hgxB00	B:7-183

(no "Pfam Domain" information available for 1HGX)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (HGXR_TRIFO | P51900)

molecular function
	GO:0052657	guanine phosphoribosyltransferase activity	Catalysis of the reaction: GMP + diphosphate = guanine + 5-phospho-alpha-D-ribose 1-diphosphate.
	GO:0004422	hypoxanthine phosphoribosyltransferase activity	Catalysis of the reaction: IMP + diphosphate = hypoxanthine + 5-phospho-alpha-D-ribose 1-diphosphate.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0016757	transferase activity, transferring glycosyl groups	Catalysis of the transfer of a glycosyl group from one compound (donor) to another (acceptor).
	GO:0000310	xanthine phosphoribosyltransferase activity	Catalysis of the reaction: 5-phospho-alpha-D-ribose 1-diphosphate + xanthine = (9-D-ribosylxanthine)-5'-phosphate + diphosphate.
biological process
	GO:0032263	GMP salvage	Any process which produces guanosine monophosphate from derivatives of it, without de novo synthesis.
	GO:0032264	IMP salvage	Any process which produces inosine monophosphate from derivatives of it, without de novo synthesis.
	GO:0032265	XMP salvage	Any process which produces xanthosine monophosphate from derivatives of it, without de novo synthesis.
	GO:0009116	nucleoside metabolic process	The chemical reactions and pathways involving a nucleoside, a nucleobase linked to either beta-D-ribofuranose (a ribonucleoside) or 2-deoxy-beta-D-ribofuranose, (a deoxyribonucleoside), e.g. adenosine, guanosine, inosine, cytidine, uridine and deoxyadenosine, deoxyguanosine, deoxycytidine and thymidine (= deoxythymidine).
	GO:0006166	purine ribonucleoside salvage	Any process which produces a purine nucleoside from derivatives of it, without de novo synthesis.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		5GP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Leu A:46 - Thr A:47	[ RasMol ]
		Leu B:46 - Thr B:47	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1hgx
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	HGXR_TRIFO \| P51900
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.4.2.8
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	HGXR_TRIFO \| P51900
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 1HGX)

(no "Related Entries Specified in the PDB File" available for 1HGX)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (13, 13)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File