1H9C - JenaLib

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   NMR STRUCTURE OF CYSTEINYL-PHOSPHORYLATED ENZYME IIB OF THE N,N'-DIACETYLCHITOBIOSE SPECIFIC PHOSPHOENOLPYRUVATE-DEPENDENT PHOSPHOTRANSFERASE SYSTEM OF ESCHERICHIA COLI.

Authors :   E. Ab, G. K. Schuurman-Wolters, D. Nijlant, K. Dijkstra, M. H. Saier, G. T. Robillard, R. M. Scheek

Date :   07 Mar 01 (Deposition) - 21 May 01 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (9x)

Keywords :   Transferase, Enzyme Iib-Chitobiose, Phosphotransferase System, Sugar Transport, Phosphorylation, Iib- Cellobiose (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   E. Ab, G. K. Schuurman-Wolters, D. Nijlant, K. Dijkstra, M. H. Saier, G. T. Robillard, R. M. Scheek
Nmr Structure Of Cysteinyl-Phosphorylated Enzyme Iib Of The N, N'-Diacetylchitobiose Specific Phosphoenolpyruvate-Dependentphosphotransferase System Of Escherichia Coli
J. Mol. Biol. V. 308 993 2001
PubMed-ID: 11352587 | Reference-DOI: 10.1006/JMBI.2001.4623
(for further references see the PDB file header)

Molecule 1 - PTS SYSTEM, CHITOBIOSE-SPECIFIC IIB COMPONENT
	Cellular Location	:	CYTOPLASM
	Chains	:	A
	EC Number	:	2.7.1.69
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PJR-BLIIB
	Expression System Strain	:	W3110
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	CHBB [PREV CELA]
	Organism Scientific	:	ESCHERICHIA COLI
	Organism Taxid	:	316407
	Other Details	:	PHOSPHORYLATION AT RESIDUE CYS10
	Plasmid	:	PJR-BLIIB
	Strain	:	W3110
	Synonym	:	EIIB-CEL, EIIB-CHB


NMR Structure (9x)	:

Summary Information (see also Sequences/Alignments below)

NMR Structure (1, 1)

No.	Name	Count	Type	Full Name
1	CSP	1	Mod. Amino Acid	S-PHOSPHOCYSTEINE

(no "Site" information available for 1H9C)

(no "SS Bond" information available for 1H9C)

(no "Cis Peptide Bond" information available for 1H9C)

(no "SAP(SNP)/Variant" information available for 1H9C)

NMR Structure (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PTS_EIIB_TYPE_3	PS51100	PTS_EIIB type-3 domain profile.	PTQB_ECO57	3-106	1	A:3-106
				PTQB_ECOL6	3-106	1	A:3-106
				PTQB_ECOLI	3-106	1	A:3-106

(no "Exon" information available for 1H9C)

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:106
 aligned with PTQB_ECO57 | P69830 from UniProtKB/Swiss-Prot  Length:106

    Alignment length:106
                                    10        20        30        40        50        60        70        80        90       100      
           PTQB_ECO57     1 MEKKHIYLFCSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAAN 106
               SCOP domains d1h9ca_ A: Enzyme IIB-cellobiose                                                                           SCOP domains
               CATH domains 1h9cA00 A:1-106  [code=3.40.50.270, no name defined]                                                       CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeee.....hhhhhhhhhhhhhhh...eeeeeee..hhhhhhh...eeee.hhhhhhhhhhhhhh....eee.hhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --PTS_EIIB_TYPE_3  PDB: A:3-106 UniProt: 3-106                                                             PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 1h9c A   1 MEKKHIYLFcSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAAN 106
                                    10        20        30        40        50        60        70        80        90       100      
                                    10-CSP

Chain A from PDB  Type:PROTEIN  Length:106
 aligned with PTQB_ECOL6 | P69796 from UniProtKB/Swiss-Prot  Length:106

    Alignment length:106
                                    10        20        30        40        50        60        70        80        90       100      
           PTQB_ECOL6     1 MEKKHIYLFCSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAAN 106
               SCOP domains d1h9ca_ A: Enzyme IIB-cellobiose                                                                           SCOP domains
               CATH domains 1h9cA00 A:1-106  [code=3.40.50.270, no name defined]                                                       CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeee.....hhhhhhhhhhhhhhh...eeeeeee..hhhhhhh...eeee.hhhhhhhhhhhhhh....eee.hhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --PTS_EIIB_TYPE_3  PDB: A:3-106 UniProt: 3-106                                                             PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 1h9c A   1 MEKKHIYLFcSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAAN 106
                                    10        20        30        40        50        60        70        80        90       100      
                                    10-CSP

Chain A from PDB  Type:PROTEIN  Length:106
 aligned with PTQB_ECOLI | P69795 from UniProtKB/Swiss-Prot  Length:106

    Alignment length:106
                                    10        20        30        40        50        60        70        80        90       100      
           PTQB_ECOLI     1 MEKKHIYLFCSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAAN 106
               SCOP domains d1h9ca_ A: Enzyme IIB-cellobiose                                                                           SCOP domains
               CATH domains 1h9cA00 A:1-106  [code=3.40.50.270, no name defined]                                                       CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeee.....hhhhhhhhhhhhhhh...eeeeeee..hhhhhhh...eeee.hhhhhhhhhhhhhh....eee.hhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --PTS_EIIB_TYPE_3  PDB: A:3-106 UniProt: 3-106                                                             PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 1h9c A   1 MEKKHIYLFcSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAAN 106
                                    10        20        30        40        50        60        70        80        90       100      
                                    10-CSP

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: Phosphotyrosine protein phosphatases I-like (60)

Superfamily: PTS system IIB component-like (10)

Family: PTS system, Lactose/Cellobiose specific IIB subunit (6)

Protein domain: Enzyme IIB-cellobiose (3)

Escherichia coli [TaxId: 562] (3)

d1h9ca_

NMR Structure

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: [code=3.40.50.270, no name defined] (36)

Escherichia coli. Organism_taxid: 316407. Strain: w3110. (1)

1h9cA00

A:1-106

(no "Pfam Domain" information available for 1H9C)

NMR Structure(hide GO term definitions)

Chain A (PTQB_ECOL6 | P69796)

molecular function
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0008982	protein-N(PI)-phosphohistidine-sugar phosphotransferase activity	Catalysis of the PEP-dependent, phosphoryl transfer-driven transport of substances across a membrane. The transport happens by catalysis of the reaction: protein N-phosphohistidine + sugar(out) = protein histidine + sugar phosphate(in). This differs from primary and secondary active transport in that the solute is modified during transport.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0034219	carbohydrate transmembrane transport	The process in which a carbohydrate is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
	GO:0008643	carbohydrate transport	The directed movement of carbohydrate into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Carbohydrates are any of a group of organic compounds based of the general formula Cx(H2O)y.
	GO:0009401	phosphoenolpyruvate-dependent sugar phosphotransferase system	The uptake and phosphorylation of specific carbohydrates from the extracellular environment; uptake and phosphorylation are coupled, making the PTS a link between the uptake and metabolism of sugars; phosphoenolpyruvate is the original phosphate donor; phosphoenolpyruvate passes the phosphate via a signal transduction pathway, to enzyme 1 (E1), which in turn passes it on to the histidine protein, HPr; the next step in the system involves sugar-specific membrane-bound complex, enzyme 2 (EII), which transports the sugar into the cell; it includes the sugar permease, which catalyzes the transport reactions; EII is usually divided into three different domains, EIIA, EIIB, and EIIC.
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Chain A (PTQB_ECOLI | P69795)

molecular function
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008982	protein-N(PI)-phosphohistidine-sugar phosphotransferase activity	Catalysis of the PEP-dependent, phosphoryl transfer-driven transport of substances across a membrane. The transport happens by catalysis of the reaction: protein N-phosphohistidine + sugar(out) = protein histidine + sugar phosphate(in). This differs from primary and secondary active transport in that the solute is modified during transport.
	GO:0090566	protein-phosphocysteine-N,N'-diacetylchitobiose phosphotransferase system transporter activity	Catalysis of the PEP-dependent, phosphoryl transfer-driven transport of substances across a membrane. The transport happens by catalysis of the reaction: protein S-phosphocysteine + N,N'-diacetylchitobiose(out) = protein cysteine + N,N'-diacetylchitobiose phosphate(in).
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:1902815	N,N'-diacetylchitobiose import	The directed movement of N,N'-diacetylchitobiose into a cell or organelle.
	GO:0034219	carbohydrate transmembrane transport	The process in which a carbohydrate is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
	GO:0008643	carbohydrate transport	The directed movement of carbohydrate into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Carbohydrates are any of a group of organic compounds based of the general formula Cx(H2O)y.
	GO:0009401	phosphoenolpyruvate-dependent sugar phosphotransferase system	The uptake and phosphorylation of specific carbohydrates from the extracellular environment; uptake and phosphorylation are coupled, making the PTS a link between the uptake and metabolism of sugars; phosphoenolpyruvate is the original phosphate donor; phosphoenolpyruvate passes the phosphate via a signal transduction pathway, to enzyme 1 (E1), which in turn passes it on to the histidine protein, HPr; the next step in the system involves sugar-specific membrane-bound complex, enzyme 2 (EII), which transports the sugar into the cell; it includes the sugar permease, which catalyzes the transport reactions; EII is usually divided into three different domains, EIIA, EIIB, and EIIC.
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Chain A (PTQB_ECO57 | P69830)

molecular function
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0008982	protein-N(PI)-phosphohistidine-sugar phosphotransferase activity	Catalysis of the PEP-dependent, phosphoryl transfer-driven transport of substances across a membrane. The transport happens by catalysis of the reaction: protein N-phosphohistidine + sugar(out) = protein histidine + sugar phosphate(in). This differs from primary and secondary active transport in that the solute is modified during transport.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0034219	carbohydrate transmembrane transport	The process in which a carbohydrate is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
	GO:0008643	carbohydrate transport	The directed movement of carbohydrate into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Carbohydrates are any of a group of organic compounds based of the general formula Cx(H2O)y.
	GO:0009401	phosphoenolpyruvate-dependent sugar phosphotransferase system	The uptake and phosphorylation of specific carbohydrates from the extracellular environment; uptake and phosphorylation are coupled, making the PTS a link between the uptake and metabolism of sugars; phosphoenolpyruvate is the original phosphate donor; phosphoenolpyruvate passes the phosphate via a signal transduction pathway, to enzyme 1 (E1), which in turn passes it on to the histidine protein, HPr; the next step in the system involves sugar-specific membrane-bound complex, enzyme 2 (EII), which transports the sugar into the cell; it includes the sugar permease, which catalyzes the transport reactions; EII is usually divided into three different domains, EIIA, EIIB, and EIIC.
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CSP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
(no "Sites" information available for 1h9c)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1h9c)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1h9c
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PTQB_ECO57 \| P69830
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	PTQB_ECOL6 \| P69796
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	PTQB_ECOLI \| P69795
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.1.69
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PTQB_ECO57 \| P69830
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	PTQB_ECOL6 \| P69796
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	PTQB_ECOLI \| P69795
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	PTQB_ECOLI \| P69795	:	1e2b 1iib 2wwv 2wy2

(no "Related Entries Specified in the PDB File" available for 1H9C)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (13, 31)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File