|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 4)
|
Asymmetric Unit (2, 2)
|
(no "SS Bond" information available for 1H4X) |
(no "Cis Peptide Bond" information available for 1H4X) |
(no "SAP(SNP)/Variant" information available for 1H4X) |
Asymmetric Unit (1, 2)
|
(no "Exon" information available for 1H4X) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:111 aligned with SP2AA_LYSSH | O32723 from UniProtKB/Swiss-Prot Length:117 Alignment length:111 11 21 31 41 51 61 71 81 91 101 111 SP2AA_LYSSH 2 HFQLEMVTRETVVIRLFGELDHHAVEQIRAKISAAIFQGTVTTIIWNLEGLSFMDSSGVGLVLGRMRELEAVAGRTILLNPSPTMRKVFQFSGLGPWMMDATEEQAIDRVR 112 SCOP domains d1h4xa_ A: Anti-sigma factor antagonist SpoIIaa SCOP domains CATH domains 1h4xA00 A:2-112 [code=3.30.750.24, no name defined] CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -----------STAS PDB: A:13-95 UniProt: 13-95 ----------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------- Transcript 1h4x A 2 AFQLEMVTRETVVIRLFGELDHHAVEQIRAKISTAIFQGAVTTIIWNFERLSFMDsSGVGLVLGRMRELEAVAGRTILLNPSPTMRKVFQFSGLGPWMMDATEEEAIDRVR 112 11 21 31 41 51 | 61 71 81 91 101 111 57-SEP Chain B from PDB Type:PROTEIN Length:111 aligned with SP2AA_LYSSH | O32723 from UniProtKB/Swiss-Prot Length:117 Alignment length:111 11 21 31 41 51 61 71 81 91 101 111 SP2AA_LYSSH 2 HFQLEMVTRETVVIRLFGELDHHAVEQIRAKISAAIFQGTVTTIIWNLEGLSFMDSSGVGLVLGRMRELEAVAGRTILLNPSPTMRKVFQFSGLGPWMMDATEEQAIDRVR 112 SCOP domains d1h4xb_ B: Anti-sigma factor antagonist SpoIIaa SCOP domains CATH domains 1h4xB00 B:2-112 [code=3.30.750.24, no name defined] CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -----------STAS PDB: B:13-95 UniProt: 13-95 ----------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------- Transcript 1h4x B 2 AFQLEMVTRETVVIRLFGELDHHAVEQIRAKISTAIFQGAVTTIIWNFERLSFMDsSGVGLVLGRMRELEAVAGRTILLNPSPTMRKVFQFSGLGPWMMDATEEEAIDRVR 112 11 21 31 41 51 | 61 71 81 91 101 111 57-SEP
|
Asymmetric Unit |
Asymmetric Unit |
(no "Pfam Domain" information available for 1H4X) |
Asymmetric Unit(hide GO term definitions) Chain A,B (SP2AA_LYSSH | O32723)
|
|
|
|
|
|
|