1GZU - JenaLib

Biol.Unit 1 - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF HUMAN NICOTINAMIDE MONONUCLEOTIDE ADENYLYLTRANSFERASE IN COMPLEX WITH NMN

Authors :   E. Werner, M. Ziegler, F. Lerner, M. Schweiger, U. Heinemann

Date :   06 Jun 02 (Deposition) - 05 Jul 02 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.90

Chains :   Asym. Unit : A,B,C
Biol. Unit 1: A,B,C  (2x)

Keywords :   Transferase, Nad Biosynthesis, Adenylyltransferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   E. Werner, M. Ziegler, F. Lerner, M. Schweiger, U. Heinemann
Crystal Structure Of Human Nicotinamide Mononucleotide Adenylyltransferase In Complex With Nmn
Febs Lett. V. 516 239 2002
PubMed-ID: 11959140 | Reference-DOI: 10.1016/S0014-5793(02)02556-5

Molecule 1 - NICOTINAMIDE MONONUCLEOTIDE ADENYLYL TRANSFERASE
	Chains	:	A, B, C
	EC Number	:	2.7.7.1
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PQE30
	Expression System Strain	:	NM522
	Expression System Taxid	:	562
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	NMN ADENYLYLTRANSFERASE

		1	2	3
Asymmetric Unit	:	A	B	C
Biological Unit 1 (2x)	:	A	B	C

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 12)

No.	Name	Count	Type	Full Name
1	MSE	9	Mod. Amino Acid	SELENOMETHIONINE
2	NMN	3	Ligand/Ion	BETA-NICOTINAMIDE RIBOSE MONOPHOSPHATE

Biological Unit 1 (2, 24)

No.	Name	Count	Type	Full Name
1	MSE	18	Mod. Amino Acid	SELENOMETHIONINE
2	NMN	6	Ligand/Ion	BETA-NICOTINAMIDE RIBOSE MONOPHOSPHATE

Asymmetric Unit (3, 3)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLY A:15 , SER A:16 , TYR A:55 , LYS A:57 , TRP A:92 , GLU A:94 , THR A:95 , LEU A:96 , LEU A:159 , LEU A:168 , TRP A:169 , ASP A:173	BINDING SITE FOR RESIDUE NMN A 501
2	AC2	SOFTWARE	GLY B:15 , SER B:16 , VAL B:51 , TYR B:55 , LYS B:57 , TRP B:92 , GLU B:94 , THR B:95 , LEU B:159 , LEU B:168 , TRP B:169	BINDING SITE FOR RESIDUE NMN B 501
3	AC3	SOFTWARE	CYS C:14 , GLY C:15 , SER C:16 , TYR C:55 , LYS C:57 , THR C:95 , LEU C:159 , LEU C:168 , TRP C:169	BINDING SITE FOR RESIDUE NMN C 501

(no "SS Bond" information available for 1GZU)

(no "Cis Peptide Bond" information available for 1GZU)

Asymmetric Unit (27, 81)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_068856	V	9	M	NMNA1_HUMAN	Disease (LCA9)	387907294	A/B/C	V	9	M
02	UniProt	VAR_068857	A	13	T	NMNA1_HUMAN	Disease (LCA9)	138613460	A/B/C	A	13	T
03	UniProt	VAR_068858	I	20	N	NMNA1_HUMAN	Disease (LCA9)	761948762	A/B/C	I	20	N
04	UniProt	VAR_068859	D	33	G	NMNA1_HUMAN	Disease (LCA9)	---	A/B/C	D	33	G
05	UniProt	VAR_068860	M	35	T	NMNA1_HUMAN	Disease (LCA9)	---	A/B/C	M	35	T
06	UniProt	VAR_068861	A	54	V	NMNA1_HUMAN	Disease (LCA9)	760965874	A/B/C	A	54	V
07	UniProt	VAR_068862	R	66	W	NMNA1_HUMAN	Disease (LCA9)	763325435	A/B/C	R	66	W
08	UniProt	VAR_068863	V	67	F	NMNA1_HUMAN	Disease (LCA9)	756903689	A/B/C	V	67	F
09	UniProt	VAR_068864	M	69	V	NMNA1_HUMAN	Disease (LCA9)	372066126	A/B/C	M	69	V
10	UniProt	VAR_068865	L	72	H	NMNA1_HUMAN	Disease (LCA9)	---	A/B/C	L	72	H
11	UniProt	VAR_068866	V	98	G	NMNA1_HUMAN	Disease (LCA9)	771336246	A/B/C	V	98	G
12	UniProt	VAR_068867	A	147	P	NMNA1_HUMAN	Disease (LCA9)	---	A/B/C	A	147	P
13	UniProt	VAR_068868	V	151	F	NMNA1_HUMAN	Disease (LCA9)	387907292	A/B/C	V	151	F
14	UniProt	VAR_068869	L	153	P	NMNA1_HUMAN	Disease (LCA9)	---	A/B/C	L	153	P
15	UniProt	VAR_068870	L	153	V	NMNA1_HUMAN	Disease (LCA9)	387907293	A/B/C	L	153	V
16	UniProt	VAR_068871	G	156	R	NMNA1_HUMAN	Disease (LCA9)	---	A/B/C	G	156	R
17	UniProt	VAR_068872	D	173	G	NMNA1_HUMAN	Disease (LCA9)	---	A/B/C	D	173	G
18	UniProt	VAR_068873	V	178	M	NMNA1_HUMAN	Disease (LCA9)	757724544	A/B/C	V	178	M
19	UniProt	VAR_068874	Y	181	C	NMNA1_HUMAN	Disease (LCA9)	748913297	A/B/C	Y	181	C
20	UniProt	VAR_068875	I	184	M	NMNA1_HUMAN	Disease (LCA9)	---	A/B/C	I	184	M
21	UniProt	VAR_068876	R	207	W	NMNA1_HUMAN	Disease (LCA9)	142968179	A/B/C	R	207	W
22	UniProt	VAR_068877	I	217	N	NMNA1_HUMAN	Disease (LCA9)	---	A/B/C	I	217	N
23	UniProt	VAR_068878	R	237	C	NMNA1_HUMAN	Disease (LCA9)	375110174	A/B/C	R	237	C
24	UniProt	VAR_068879	R	237	L	NMNA1_HUMAN	Disease (LCA9)	368062092	A/B/C	R	237	L
25	UniProt	VAR_068880	L	239	S	NMNA1_HUMAN	Disease (LCA9)	778606847	A/B/C	L	239	S
26	UniProt	VAR_068881	H	251	P	NMNA1_HUMAN	Disease (LCA9)	---	A/B/C	H	251	P
27	UniProt	VAR_068882	E	257	K	NMNA1_HUMAN	Disease (LCA9)	150726175	A/B/C	E	257	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (27, 162)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_068856	V	9	M	NMNA1_HUMAN	Disease (LCA9)	387907294	A/B/C	V	9	M
02	UniProt	VAR_068857	A	13	T	NMNA1_HUMAN	Disease (LCA9)	138613460	A/B/C	A	13	T
03	UniProt	VAR_068858	I	20	N	NMNA1_HUMAN	Disease (LCA9)	761948762	A/B/C	I	20	N
04	UniProt	VAR_068859	D	33	G	NMNA1_HUMAN	Disease (LCA9)	---	A/B/C	D	33	G
05	UniProt	VAR_068860	M	35	T	NMNA1_HUMAN	Disease (LCA9)	---	A/B/C	M	35	T
06	UniProt	VAR_068861	A	54	V	NMNA1_HUMAN	Disease (LCA9)	760965874	A/B/C	A	54	V
07	UniProt	VAR_068862	R	66	W	NMNA1_HUMAN	Disease (LCA9)	763325435	A/B/C	R	66	W
08	UniProt	VAR_068863	V	67	F	NMNA1_HUMAN	Disease (LCA9)	756903689	A/B/C	V	67	F
09	UniProt	VAR_068864	M	69	V	NMNA1_HUMAN	Disease (LCA9)	372066126	A/B/C	M	69	V
10	UniProt	VAR_068865	L	72	H	NMNA1_HUMAN	Disease (LCA9)	---	A/B/C	L	72	H
11	UniProt	VAR_068866	V	98	G	NMNA1_HUMAN	Disease (LCA9)	771336246	A/B/C	V	98	G
12	UniProt	VAR_068867	A	147	P	NMNA1_HUMAN	Disease (LCA9)	---	A/B/C	A	147	P
13	UniProt	VAR_068868	V	151	F	NMNA1_HUMAN	Disease (LCA9)	387907292	A/B/C	V	151	F
14	UniProt	VAR_068869	L	153	P	NMNA1_HUMAN	Disease (LCA9)	---	A/B/C	L	153	P
15	UniProt	VAR_068870	L	153	V	NMNA1_HUMAN	Disease (LCA9)	387907293	A/B/C	L	153	V
16	UniProt	VAR_068871	G	156	R	NMNA1_HUMAN	Disease (LCA9)	---	A/B/C	G	156	R
17	UniProt	VAR_068872	D	173	G	NMNA1_HUMAN	Disease (LCA9)	---	A/B/C	D	173	G
18	UniProt	VAR_068873	V	178	M	NMNA1_HUMAN	Disease (LCA9)	757724544	A/B/C	V	178	M
19	UniProt	VAR_068874	Y	181	C	NMNA1_HUMAN	Disease (LCA9)	748913297	A/B/C	Y	181	C
20	UniProt	VAR_068875	I	184	M	NMNA1_HUMAN	Disease (LCA9)	---	A/B/C	I	184	M
21	UniProt	VAR_068876	R	207	W	NMNA1_HUMAN	Disease (LCA9)	142968179	A/B/C	R	207	W
22	UniProt	VAR_068877	I	217	N	NMNA1_HUMAN	Disease (LCA9)	---	A/B/C	I	217	N
23	UniProt	VAR_068878	R	237	C	NMNA1_HUMAN	Disease (LCA9)	375110174	A/B/C	R	237	C
24	UniProt	VAR_068879	R	237	L	NMNA1_HUMAN	Disease (LCA9)	368062092	A/B/C	R	237	L
25	UniProt	VAR_068880	L	239	S	NMNA1_HUMAN	Disease (LCA9)	778606847	A/B/C	L	239	S
26	UniProt	VAR_068881	H	251	P	NMNA1_HUMAN	Disease (LCA9)	---	A/B/C	H	251	P
27	UniProt	VAR_068882	E	257	K	NMNA1_HUMAN	Disease (LCA9)	150726175	A/B/C	E	257	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 1GZU)

Asymmetric Unit (4, 12)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000377205	1a	ENSE00001473110	chr1:10003486-10003573	88	NMNA1_HUMAN	-	0	0	-	-
1.2a	ENST00000377205	2a	ENSE00002202044	chr1:10032076-10032246	171	NMNA1_HUMAN	1-39	39	3	A:6-39 B:6-39 C:6-39	34 34 34
1.3	ENST00000377205	3	ENSE00001682224	chr1:10035650-10035833	184	NMNA1_HUMAN	39-100	62	3	A:39-100 B:39-100 C:39-100	62 62 62
1.4a	ENST00000377205	4a	ENSE00001180526	chr1:10041089-10041228	140	NMNA1_HUMAN	100-147	48	3	A:100-147 (gaps) B:100-147 (gaps) C:100-147 (gaps)	48 48 48
1.6b	ENST00000377205	6b	ENSE00001473095	chr1:10042359-10045556	3198	NMNA1_HUMAN	147-279	133	3	A:147-271 B:147-271 C:147-271	125 125 125

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:228
 aligned with NMNA1_HUMAN | Q9HAN9 from UniProtKB/Swiss-Prot  Length:279

    Alignment length:266
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265      
          NMNA1_HUMAN     6 KTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKSLEPKTKAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQ 271
               SCOP domains d1gzua_ A: Nicotinamide mononucleotide (NMN) adenylyltransferase                                                                                                                                                                                                           SCOP domains
               CATH domains 1gzuA00 A:6-271 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1                                                                                                                                                                                                      CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeee.....hhhhhhhhhhhhhhhhh....eeeeeeeee.hhhhh.....hhhhhhhhhhhhhh....eee.hhhhhh....hhhhhhhhhhhhhh.--------------------------------------...eeeeeehhhhhhhh......hhhhhhhhhhhheeeeee.hhhhhhhhhhhhhhhhhh...eeeee.......hhhhhhhhhhh........hhhhhhhhhh..................... Sec.struct. author
             SAPs(SNPs) (1) ---M---T------N------------G-T------------------V-----------WF-V--H-------------------------G------------------------------------------------P---F-P--R----------------G----M--C--M----------------------W---------N-------------------C-S-----------P-----K-------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------------------------------------------------------------------------------------------------------------------V-----------------------------------------------------------------------------------L---------------------------------- SAPs(SNPs) (2)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: A:6-39            ------------------------------------------------------------Exon 1.4a  PDB: A:100-147 (gaps)                ---------------------------------------------------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------Exon 1.3  PDB: A:39-100 UniProt: 39-100                       ----------------------------------------------Exon 1.6b  PDB: A:147-271 UniProt: 147-279 [INCOMPLETE]                                                                       Transcript 1 (2)
                 1gzu A   6 KTEVVLLACGSFNPITNmHLRLFELAKDYmNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVImAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEA--------------------------------------AVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQ 271
                                    15       |25        35        45        55        65   |    75        85        95       105  |      -         -         -         - |     155       165       175       185       195       205       215       225       235       245       255       265      
                                            23-MSE      35-MSE                            69-MSE                                108                                    147

Chain B from PDB  Type:PROTEIN  Length:228
 aligned with NMNA1_HUMAN | Q9HAN9 from UniProtKB/Swiss-Prot  Length:279

    Alignment length:266
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265      
          NMNA1_HUMAN     6 KTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKSLEPKTKAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQ 271
               SCOP domains d1gzub_ B: Nicotinamide mononucleotide (NMN) adenylyltransferase                                                                                                                                                                                                           SCOP domains
               CATH domains 1gzuB00 B:6-271 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1                                                                                                                                                                                                      CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeee.....hhhhhhhhhhhhhhhhh....eeeeeeeee.hhhhh.....hhhhhhhhhhhhhh....eee.hhhhhh....hhhhhhhhhhhhhh.--------------------------------------...eeeeeehhhhhhhh......hhhhhhhhhhhheeeeee.hhhhhhhhhhhhhhhhhh...eeeee.......hhhhhhhhhhh........hhhhhhhhhh..................... Sec.struct. author
             SAPs(SNPs) (1) ---M---T------N------------G-T------------------V-----------WF-V--H-------------------------G------------------------------------------------P---F-P--R----------------G----M--C--M----------------------W---------N-------------------C-S-----------P-----K-------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------------------------------------------------------------------------------------------------------------------V-----------------------------------------------------------------------------------L---------------------------------- SAPs(SNPs) (2)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: B:6-39            ------------------------------------------------------------Exon 1.4a  PDB: B:100-147 (gaps)                ---------------------------------------------------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------Exon 1.3  PDB: B:39-100 UniProt: 39-100                       ----------------------------------------------Exon 1.6b  PDB: B:147-271 UniProt: 147-279 [INCOMPLETE]                                                                       Transcript 1 (2)
                 1gzu B   6 KTEVVLLACGSFNPITNmHLRLFELAKDYmNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVImAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEA--------------------------------------AVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQ 271
                                    15       |25        35        45        55        65   |    75        85        95       105  |      -         -         -         - |     155       165       175       185       195       205       215       225       235       245       255       265      
                                            23-MSE      35-MSE                            69-MSE                                108                                    147

Chain C from PDB  Type:PROTEIN  Length:228
 aligned with NMNA1_HUMAN | Q9HAN9 from UniProtKB/Swiss-Prot  Length:279

    Alignment length:266
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265      
          NMNA1_HUMAN     6 KTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKSLEPKTKAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQ 271
               SCOP domains d1gzuc_ C: Nicotinamide mononucleotide (NMN) adenylyltransferase                                                                                                                                                                                                           SCOP domains
               CATH domains 1gzuC00 C:6-271 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1                                                                                                                                                                                                      CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeee.....hhhhhhhhhhhhhhhhh....eeeeeeeee.hhhhh.....hhhhhhhhhhhhhh....eee.hhhhhh....hhhhhhhhhhhhhh.--------------------------------------...eeeeeehhhhhhhh......hhhhhhhhhhhheeeeee.hhhhhhhhhhhhhhhhhh...eeeee.......hhhhhhhhhhh........hhhhhhhhhh..................... Sec.struct. author
             SAPs(SNPs) (1) ---M---T------N------------G-T------------------V-----------WF-V--H-------------------------G------------------------------------------------P---F-P--R----------------G----M--C--M----------------------W---------N-------------------C-S-----------P-----K-------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------------------------------------------------------------------------------------------------------------------V-----------------------------------------------------------------------------------L---------------------------------- SAPs(SNPs) (2)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: C:6-39            ------------------------------------------------------------Exon 1.4a  PDB: C:100-147 (gaps)                ---------------------------------------------------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------Exon 1.3  PDB: C:39-100 UniProt: 39-100                       ----------------------------------------------Exon 1.6b  PDB: C:147-271 UniProt: 147-279 [INCOMPLETE]                                                                       Transcript 1 (2)
                 1gzu C   6 KTEVVLLACGSFNPITNmHLRLFELAKDYmNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVImAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEA--------------------------------------AVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQ 271
                                    15       |25        35        45        55        65   |    75        85        95       105  |      -         -         -         - |     155       165       175       185       195       205       215       225       235       245       255       265      
                                            23-MSE      35-MSE                            69-MSE                                108                                    147

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: Adenine nucleotide alpha hydrolase-like (440)

Superfamily: Nucleotidylyl transferase (325)

Family: Adenylyltransferase (56)

Protein domain: Nicotinamide mononucleotide (NMN) adenylyltransferase (22)

Human (Homo sapiens) [TaxId: 9606] (5)

1a	d1gzua_	A:
1b	d1gzub_	B:
1c	d1gzuc_	C:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1 (328)

Human (Homo sapiens) (27)

1a	1gzuA00	A:6-271
1b	1gzuB00	B:6-271
1c	1gzuC00	C:6-271

(no "Pfam Domain" information available for 1GZU)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C (NMNA1_HUMAN | Q9HAN9)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0000309	nicotinamide-nucleotide adenylyltransferase activity	Catalysis of the reaction: ATP + nicotinamide nucleotide = diphosphate + NAD+.
	GO:0004515	nicotinate-nucleotide adenylyltransferase activity	Catalysis of the reaction: ATP + nicotinate ribonucleotide = diphosphate + deamido-NAD+.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0016779	nucleotidyltransferase activity	Catalysis of the transfer of a nucleotidyl group to a reactant.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0034628	'de novo' NAD biosynthetic process from aspartate	The chemical reactions and pathways resulting in the formation of nicotinamide adenine dinucleotide (NAD), beginning with the synthesis of aspartate from simpler precursors; biosynthesis may be of either the oxidized form, NAD, or the reduced form, NADH.
	GO:0009435	NAD biosynthetic process	The chemical reactions and pathways resulting in the formation of nicotinamide adenine dinucleotide, a coenzyme present in most living cells and derived from the B vitamin nicotinic acid; biosynthesis may be of either the oxidized form, NAD, or the reduced form, NADH.
	GO:0019674	NAD metabolic process	The chemical reactions and pathways involving nicotinamide adenine dinucleotide (NAD), a coenzyme present in most living cells and derived from the B vitamin nicotinic acid.
	GO:0009058	biosynthetic process	The chemical reactions and pathways resulting in the formation of substances; typically the energy-requiring part of metabolism in which simpler substances are transformed into more complex ones.
	GO:0019363	pyridine nucleotide biosynthetic process	The chemical reactions and pathways resulting in the formation of a pyridine nucleotide, a nucleotide characterized by a pyridine derivative as a nitrogen base.
	GO:0009611	response to wounding	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to the organism.
cellular component
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NMN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1gzu)

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1gzu
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	NMNA1_HUMAN \| Q9HAN9
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.7.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	608553
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	NMNA1_HUMAN \| Q9HAN9
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	NMNA1_HUMAN \| Q9HAN9	:	1kku 1kqn 1kqo 1kr2

1gry	CRYSTAL STRUCTURE OF HUMAN NICOTINAMIDE MONONUCLEOTIDE ADENYLYLTRANSFERASE IN COMPLEX WITH NMN

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 12)

Sites (3, 3)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (27, 81)

PROSITE Motifs (0, 0)

Exons (4, 12)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 3)

CATH Domains (1, 3)

Pfam Domains (0, 0)

Gene Ontology (16, 16)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File