|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1GXH) |
Sites (0, 0)| (no "Site" information available for 1GXH) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1GXH) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1GXH) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1GXH) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1GXH) |
Exons (0, 0)| (no "Exon" information available for 1GXH) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:85 aligned with IMM8_ECOLX | P09881 from UniProtKB/Swiss-Prot Length:85 Alignment length:85 10 20 30 40 50 60 70 80 IMM8_ECOLX 1 MELKNSISDYTETEFKKIIEDIINCEGDEKKQDDNLEHFISVTEHPSGSDLIYYPEGNNDGSPEAVIKEIKEWRAANGKSGFKQG 85 SCOP domains d1gxha_ A: ImmE8 (Im8) SCOP domains CATH domains 1gxhA00 A:1-85 [code=1.10.1200.20, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------- Transcript 1gxh A 1 MELKNSISDYTETEFKKIIEDIINCEGDEKKQDDNLEHFISVTEHPSGSDLIYYPEGNNDGSPEAVIKEIKEWRAANGKSGFKQG 85 10 20 30 40 50 60 70 80
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1GXH) |
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (IMM8_ECOLX | P09881)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|