Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  AN AVIAN CLASS-MU GLUTATHIONE S-TRANSFERASE, CGSTM1-1 AT 1.94 ANGSTROM RESOLUTION
 
Authors :  Y. -J. Sun, C. Kuan, M. F. Tam, C. -D. Hsiao
Date :  02 Sep 97  (Deposition) - 04 Mar 98  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.94
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Detoxification Enzyme, Glutathione S-Transferase, S-Hexyl Glutathione (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Y. J. Sun, I. C. Kuan, M. F. Tam, C. D. Hsiao
The Three-Dimensional Structure Of An Avian Class-Mu Glutathione S-Transferase, Cgstm1-1 At 1. 94 A Resolution.
J. Mol. Biol. V. 278 239 1998
PubMed-ID: 9571047  |  Reference-DOI: 10.1006/JMBI.1998.1716
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CLASS-MU GLUTATHIONE S-TRANSFERASE
    Chains: A, B
    EC Number: 2.5.1.18
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Gene: CGSTM1
    Expression System Plasmid: PGCL201
    Expression System Taxid: 562
    Gene: CGSTM1
    Organism Common: CHICKEN
    Organism Scientific: GALLUS GALLUS
    Organism Taxid: 9031
    Strain: LEGHORN
    Synonym: GST, CGSTM1-1
    Tissue: LIVER

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1GTX2Ligand/IonS-HEXYLGLUTATHIONE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:6 , TRP A:7 , ILE A:9 , TRP A:45 , LYS A:49 , ASN A:58 , LEU A:59 , GLN A:71 , SER A:72 , TYR A:115 , TRP A:209 , HOH A:223 , HOH A:229 , ASP B:105BINDING SITE FOR RESIDUE GTX A 220
2AC2SOFTWAREASP A:105 , TYR B:6 , TRP B:7 , GLY B:11 , LEU B:12 , TRP B:45 , ASN B:58 , LEU B:59 , GLN B:71 , SER B:72 , ARG B:107 , GLN B:165 , ILE B:207 , HOH B:223BINDING SITE FOR RESIDUE GTX B 220

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1GSU)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1Ala A:37 -Pro A:38
2Leu A:59 -Pro A:60
3Ala A:205 -Pro A:206
4Ala B:37 -Pro B:38
5Leu B:59 -Pro B:60
6Ala B:205 -Pro B:206

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1GSU)

(-) PROSITE Motifs  (1, 2)

Asymmetric/Biological Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GST_CTERPS50405 Soluble glutathione S-transferase C-terminal domain profile.GSTM2_CHICK90-208
 		  2A:89-207
B:89-207

(-) Exons   (0, 0)

(no "Exon" information available for 1GSU)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:217
 aligned with GSTM2_CHICK | P20136 from UniProtKB/Swiss-Prot  Length:220

    Alignment length:217
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       
          GSTM2_CHICK     2 VVTLGYWDIRGLAHAIRLLLEYTETPYQERRYKAGPAPDFDPSDWTNEKEKLGLDFPNLPYLIDGDVKLTQSNAILRYIARKHNMCGETEVEKQRVDVLENHLMDLRMAFARLCYSPDFEKLKPAYLEQLPGKLRQLSRFLGSRSWFVGDKLTFVDFLAYDVLDQQRMFVPDCPELQGNLSQFLQRFEALEKISAYMRSGRFMKAPIFWYTALWNNK 218
               SCOP domains d1gsua2 A:1-84 Class mu GST                                                         d1gsua1 A:85-217 Class mu GST                                                                                                         SCOP domains
               CATH domains 1gsuA01 A:1-85,A:191-217 Glutaredoxin                                                1gsuA02 A:86-190  [code=1.20.1050.10, no name defined]                                                   1gsuA01 A:1-85,A:191-217    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee...hhhhhhhhhhhh....eeeeee.........hhhhh..hhh.........eeee..eeee.hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhh....hhh..hhhhhhhhhh..hhhhhhh.................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------GST_CTER  PDB: A:89-207 UniProt: 90-208                                                                                ---------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1gsu A   1 VVTLGYWDIRGLAHAIRLLLEYTETPYQERRYKAGPAPDFDPSDWTNEKEKLGLDFPNLPYLIDGDVKLTQSNAILRYIARKHNMCGETEVEKQRVDVLENHLMDLRMAFARLCYSPDFEKLKPAYLEQLPGKLRQLSRFLGSRSWFVGDKLTFVDFLAYDVLDQQRMFVPDCPELQGNLSQFLQRFEALEKISAYMRSGRFMKAPIFWYTALWNNK 217
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       


Chain B from PDB  Type:PROTEIN  Length:217
 aligned with GSTM2_CHICK | P20136 from UniProtKB/Swiss-Prot  Length:220

    Alignment length:217
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       
          GSTM2_CHICK     2 VVTLGYWDIRGLAHAIRLLLEYTETPYQERRYKAGPAPDFDPSDWTNEKEKLGLDFPNLPYLIDGDVKLTQSNAILRYIARKHNMCGETEVEKQRVDVLENHLMDLRMAFARLCYSPDFEKLKPAYLEQLPGKLRQLSRFLGSRSWFVGDKLTFVDFLAYDVLDQQRMFVPDCPELQGNLSQFLQRFEALEKISAYMRSGRFMKAPIFWYTALWNNK 218
               SCOP domains d1gsub2 B:1-84 Class mu GST                                                         d1gsub1 B:85-217 Class mu GST                                                                                                         SCOP domains
               CATH domains 1gsuB01 B:1-85,B:191-217 Glutaredoxin                                                1gsuB02 B:86-190  [code=1.20.1050.10, no name defined]                                                   1gsuB01 B:1-85,B:191-217    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee...hhhhhhhhhhhhh...eeeeee..........hhhhhhh...........eeee..eee..hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhh.........hhhhhhhhhhh.hhhhhhh.................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------GST_CTER  PDB: B:89-207 UniProt: 90-208                                                                                ---------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1gsu B   1 VVTLGYWDIRGLAHAIRLLLEYTETPYQERRYKAGPAPDFDPSDWTNEKEKLGLDFPNLPYLIDGDVKLTQSNAILRYIARKHNMCGETEVEKQRVDVLENHLMDLRMAFARLCYSPDFEKLKPAYLEQLPGKLRQLSRFLGSRSWFVGDKLTFVDFLAYDVLDQQRMFVPDCPELQGNLSQFLQRFEALEKISAYMRSGRFMKAPIFWYTALWNNK 217
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1GSU)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (GSTM2_CHICK | P20136)
molecular function
    GO:0004364    glutathione transferase activity    Catalysis of the reaction: R-X + glutathione = H-X + R-S-glutathione. R may be an aliphatic, aromatic or heterocyclic group; X may be a sulfate, nitrile or halide group.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GTX  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala A:205 - Pro A:206   [ RasMol ]  
    Ala A:37 - Pro A:38   [ RasMol ]  
    Ala B:205 - Pro B:206   [ RasMol ]  
    Ala B:37 - Pro B:38   [ RasMol ]  
    Leu A:59 - Pro A:60   [ RasMol ]  
    Leu B:59 - Pro B:60   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1gsu
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GSTM2_CHICK | P20136
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.5.1.18
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  GSTM2_CHICK | P20136
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GSTM2_CHICK | P20136: 1c72

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1GSU)