1GRW - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   C. ELEGANS MAJOR SPERM PROTEIN

Authors :   A. M. E. Baker, T. M. Roberts, M. Stewart

Date :   18 Dec 01 (Deposition) - 13 Jun 02 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.60

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: D  (1x)

Keywords :   Cytosketal Protein, Cytoskeleton, Sperm, Cell Motility (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. M. E. Baker, T. M. Roberts, M. Stewart
2. 6 A Resolution Crystal Structure Of Helices Of The Motile Major Sperm Protein (Msp) Of Caenorhabditis Elegans
J. Mol. Biol. V. 319 491 2002
PubMed-ID: 12051923 | Reference-DOI: 10.1016/S0022-2836(02)00294-2

Molecule 1 - MAJOR SPERM PROTEIN 31/40/142
	Cell	:	SPERM
	Chains	:	A, B, C, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Variant	:	PLYSS
	Expression System Vector	:	PET15B
	Organism Common	:	C.ELEGANS
	Organism Scientific	:	CAENORHABDITIS ELEGANS
	Organism Taxid	:	6239
	Synonym	:	MSP

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C
Biological Unit 4 (1x)	:				D

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1GRW)

(no "Site" information available for 1GRW)

(no "SS Bond" information available for 1GRW)

Asymmetric Unit

No.	Residues
1	Gln A:12	-	Pro A:13
2	Ala A:21	-	Pro A:22
3	Asp A:56	-	Pro A:57
4	Gln B:12	-	Pro B:13
5	Ala B:21	-	Pro B:22
6	Asp B:56	-	Pro B:57
7	Gln C:12	-	Pro C:13
8	Ala C:21	-	Pro C:22
9	Asp C:56	-	Pro C:57
10	Gln D:12	-	Pro D:13
11	Ala D:21	-	Pro D:22
12	Asp D:56	-	Pro D:57

(no "SAP(SNP)/Variant" information available for 1GRW)

Asymmetric Unit (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	MSP	PS50202	Major sperm protein (MSP) domain profile.	MSP19_CAEEL	9-126	4	A:8-125 B:8-125 C:8-125 D:8-125

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	MSP	PS50202	Major sperm protein (MSP) domain profile.	MSP19_CAEEL	9-126	1	A:8-125 - - -

Biological Unit 2 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	MSP	PS50202	Major sperm protein (MSP) domain profile.	MSP19_CAEEL	9-126	1	- B:8-125 - -

Biological Unit 3 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	MSP	PS50202	Major sperm protein (MSP) domain profile.	MSP19_CAEEL	9-126	1	- - C:8-125 -

Biological Unit 4 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	MSP	PS50202	Major sperm protein (MSP) domain profile.	MSP19_CAEEL	9-126	1	- - - D:8-125

(no "Exon" information available for 1GRW)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:124
 aligned with MSP19_CAEEL | P53017 from UniProtKB/Swiss-Prot  Length:127

    Alignment length:124
                                    13        23        33        43        53        63        73        83        93       103       113       123    
          MSP19_CAEEL     4 SVPPGDIQTQPGTKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTTNMKRLGVDPPCGVLDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKNLPIEYNP 127
               SCOP domains d1grwa_ A: Major sperm protein, MSP                                                                                          SCOP domains
               CATH domains 1grwA00 A:3-126 PapD-like                                                                                                    CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee....eeee......eeeeeeeee.....eeeeeee.....eeee..eeee....eeeeeeee...hhhhh.....eeeeeeee.........hhhhhh.....eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----MSP  PDB: A:8-125 UniProt: 9-126                                                                                      - PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript
                 1grw A   3 SVPPGDIQTQPGTKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTTNMKRLGVDPPCGVLDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKNLPIEYNP 126
                                    12        22        32        42        52        62        72        82        92       102       112       122

Chain B from PDB  Type:PROTEIN  Length:124
 aligned with MSP19_CAEEL | P53017 from UniProtKB/Swiss-Prot  Length:127

    Alignment length:124
                                    13        23        33        43        53        63        73        83        93       103       113       123    
          MSP19_CAEEL     4 SVPPGDIQTQPGTKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTTNMKRLGVDPPCGVLDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKNLPIEYNP 127
               SCOP domains d1grwb_ B: Major sperm protein, MSP                                                                                          SCOP domains
               CATH domains 1grwB00 B:3-126 PapD-like                                                                                                    CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee....eeee......eeeeeeeee.....eeeeeee.....eeee..eeee....eeeeeeee.............eeeeeeee..........hhhhhh.eeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----MSP  PDB: B:8-125 UniProt: 9-126                                                                                      - PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript
                 1grw B   3 SVPPGDIQTQPGTKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTTNMKRLGVDPPCGVLDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKNLPIEYNP 126
                                    12        22        32        42        52        62        72        82        92       102       112       122

Chain C from PDB  Type:PROTEIN  Length:124
 aligned with MSP19_CAEEL | P53017 from UniProtKB/Swiss-Prot  Length:127

    Alignment length:124
                                    13        23        33        43        53        63        73        83        93       103       113       123    
          MSP19_CAEEL     4 SVPPGDIQTQPGTKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTTNMKRLGVDPPCGVLDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKNLPIEYNP 127
               SCOP domains d1grwc_ C: Major sperm protein, MSP                                                                                          SCOP domains
               CATH domains 1grwC00 C:3-126 PapD-like                                                                                                    CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eee..............eeeeeeee..................eeee..........eeeeeeee..............................hhhhhh..eeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----MSP  PDB: C:8-125 UniProt: 9-126                                                                                      - PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript
                 1grw C   3 SVPPGDIQTQPGTKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTTNMKRLGVDPPCGVLDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKNLPIEYNP 126
                                    12        22        32        42        52        62        72        82        92       102       112       122

Chain D from PDB  Type:PROTEIN  Length:124
 aligned with MSP19_CAEEL | P53017 from UniProtKB/Swiss-Prot  Length:127

    Alignment length:124
                                    13        23        33        43        53        63        73        83        93       103       113       123    
          MSP19_CAEEL     4 SVPPGDIQTQPGTKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTTNMKRLGVDPPCGVLDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKNLPIEYNP 127
               SCOP domains d1grwd_ D: Major sperm protein, MSP                                                                                          SCOP domains
               CATH domains 1grwD00 D:3-126 PapD-like                                                                                                    CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee....eeee......eeeeeeeee.....eeeeeee.....eeee..eeee....eeeeeeee.............eeeeeeee.........hhhhhh.....eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----MSP  PDB: D:8-125 UniProt: 9-126                                                                                      - PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript
                 1grw D   3 SVPPGDIQTQPGTKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTTNMKRLGVDPPCGVLDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKNLPIEYNP 126
                                    12        22        32        42        52        62        72        82        92       102       112       122

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: Immunoglobulin-like beta-sandwich (7299)

Superfamily: PapD-like (47)

Family: MSP-like (8)

Protein domain: Major sperm protein, MSP (5)

Nematode (Caenorhabditis elegans) [TaxId: 6239] (1)

1a	d1grwa_	A:
1b	d1grwb_	B:
1c	d1grwc_	C:
1d	d1grwd_	D:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Sandwich (5577)

Topology: Immunoglobulin-like (3897)

Homologous Superfamily: PapD-like (38)

C (Caenorhabditis elegans) (1)

1a	1grwA00	A:3-126
1b	1grwB00	B:3-126
1c	1grwC00	C:3-126
1d	1grwD00	D:3-126

(no "Pfam Domain" information available for 1GRW)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (MSP19_CAEEL | P53017)


GO:0042995	cell projection	A prolongation or process extending from a cell, e.g. a flagellum or axon.
GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
GO:0031143	pseudopodium	A temporary protrusion or retractile process of a cell, associated with flowing movements of the protoplasm, and serving for locomotion and feeding.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1grw)

	Sites
(no "Sites" information available for 1grw)

	Cis Peptide Bonds
		Ala A:21 - Pro A:22	[ RasMol ]
		Ala B:21 - Pro B:22	[ RasMol ]
		Ala C:21 - Pro C:22	[ RasMol ]
		Ala D:21 - Pro D:22	[ RasMol ]
		Asp A:56 - Pro A:57	[ RasMol ]
		Asp B:56 - Pro B:57	[ RasMol ]
		Asp C:56 - Pro C:57	[ RasMol ]
		Asp D:56 - Pro D:57	[ RasMol ]
		Gln A:12 - Pro A:13	[ RasMol ]
		Gln B:12 - Pro B:13	[ RasMol ]
		Gln C:12 - Pro C:13	[ RasMol ]
		Gln D:12 - Pro D:13	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1grw
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	MSP19_CAEEL \| P53017
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	MSP19_CAEEL \| P53017
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 1GRW)

(no "Related Entries Specified in the PDB File" available for 1GRW)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (12, 12)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 4)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (0, 0)

Gene Ontology (4, 4)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File