1GOP - JenaLib

Theoretical Model (Jmol Viewer)

Title :   STRUCTURE OF THE C3B-BINDING SITE OF CR1 (CD35), THE IMMUNE ADHERENCE RECEPTOR

Authors :   B. O. Smith, R. L. Mallin, M. Krych-Goldberg, X. Wang, R. E. Hauhart, K. Bromek, D. Uhrin, J. P. Atkinson, P. N. Barlow

Date :   22 Oct 01 (Deposition) - 18 Apr 02 (Release) - 18 Apr 02 (Revision)

Method :   THEORETICAL MODEL

Resolution :   NOT APPLICABLE

Chains :   Theor. Model : A

Keywords :   Complement, Module, Scr, Modelled Structure (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   B. Smith, R. Mallin, M. Krych-Goldberg, X. Wang, R. Hauhart, K. Bromek, D. Uhrin, J. Atkinson, P. Barlow
Structure Of The C3B Binding Site Of Cr1 (Cd35), The Immune Adherence Receptor
Cell(Cambridge, Mass. ) V. 108 769 2002
PubMed: search
(for further references see the PDB file header)

Molecule 1 - COMPLEMENT RECEPTOR TYPE 1
	Chains	:	A
	Fragment	:	MODULES 15,16 AND 17, OF SITE 2 RESIDUE 942-1133
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Other Details	:	SITE 2 IS A C3B/C4B BINDING SITE
	Other Details - Source	:	MODELLED STRUCTURE
	Synonym	:	CR1, C3B/C4B RECEPTOR, CD35 ANTIGEN


Theoretical Model	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1GOP)

(no "Site" information available for 1GOP)

Theoretical Model

No.	Residues
1	A:902	-	A:945
2	A:932	-	A:958
3	A:963	-	A:1004
4	A:990	-	A:1020
5	A:1025	-	A:1074
6	A:1054	-	A:1091

(no "Cis Peptide Bond" information available for 1GOP)

(no "SAP(SNP)/Variant" information available for 1GOP)

Theoretical Model (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SUSHI	PS50923	Sushi/CCP/SCR domain profile.	CR1_HUMAN	41-101 102-163 164-234 295-355 236-293 356-418 419-489 491-551 552-613 614-684 745-805 686-743 806-868 869-939 941-1001 1002-1063 1064-1134 1195-1255 1136-1193 1256-1318 1319-1389 1394-1454 1455-1516 1517-1587 1648-1708 1589-1646 1709-1771 1772-1842 1846-1906 1907-1967	2	- - - - - - - - - - - - - - - A:961-1022 A:1023-1092 - - - - - - - - - - - - -

Theoretical Model (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1c	ENST00000367053	1c	ENSE00001443318	chr1:207669502-207669733	232	CR1_HUMAN	1-41	41	0	-	-
1.2	ENST00000367053	2	ENSE00001653333	chr1:207679249-207679428	180	CR1_HUMAN	41-101	61	0	-	-
1.3a	ENST00000367053	3a	ENSE00001772738	chr1:207680059-207680158	100	CR1_HUMAN	101-134	34	0	-	-
1.4	ENST00000367053	4	ENSE00001701427	chr1:207684914-207684999	86	CR1_HUMAN	134-163	30	0	-	-
1.5	ENST00000367053	5	ENSE00001655656	chr1:207696956-207697354	399	CR1_HUMAN	163-296	134	0	-	-
1.6	ENST00000367053	6	ENSE00001645921	chr1:207700098-207700274	177	CR1_HUMAN	296-355	60	0	-	-
1.7	ENST00000367053	7	ENSE00001599723	chr1:207700366-207700468	103	CR1_HUMAN	355-389	35	0	-	-
1.8	ENST00000367053	8	ENSE00001691683	chr1:207702061-207702146	86	CR1_HUMAN	389-418	30	0	-	-
1.9	ENST00000367053	9	ENSE00001728445	chr1:207705525-207705743	219	CR1_HUMAN	418-491	74	0	-	-
1.10	ENST00000367053	10	ENSE00001753192	chr1:207706754-207706933	180	CR1_HUMAN	491-551	61	0	-	-
1.11a	ENST00000367053	11a	ENSE00001689484	chr1:207707542-207707641	100	CR1_HUMAN	551-584	34	0	-	-
1.12	ENST00000367053	12	ENSE00001657834	chr1:207713326-207713411	86	CR1_HUMAN	584-613	30	0	-	-
1.22	ENST00000367053	22	ENSE00001741034	chr1:207734084-207734482	399	CR1_HUMAN	613-746	134	0	-	-
1.23	ENST00000367053	23	ENSE00001636982	chr1:207737209-207737385	177	CR1_HUMAN	746-805	60	0	-	-
1.24	ENST00000367053	24	ENSE00001679418	chr1:207737477-207737579	103	CR1_HUMAN	805-839	35	0	-	-
1.25	ENST00000367053	25	ENSE00001664101	chr1:207739183-207739268	86	CR1_HUMAN	839-868	30	0	-	-
1.26	ENST00000367053	26	ENSE00001760896	chr1:207741169-207741387	219	CR1_HUMAN	868-941	74	0	-	-
1.27	ENST00000367053	27	ENSE00001615740	chr1:207742404-207742583	180	CR1_HUMAN	941-1001	61	1	A:901-960	60
1.28a	ENST00000367053	28a	ENSE00001766771	chr1:207743192-207743291	100	CR1_HUMAN	1001-1034	34	1	A:960-993	34
1.29	ENST00000367053	29	ENSE00001735040	chr1:207748940-207749025	86	CR1_HUMAN	1034-1063	30	1	A:993-1022	30
1.30	ENST00000367053	30	ENSE00001745761	chr1:207751150-207751548	399	CR1_HUMAN	1063-1196	134	1	A:1022-1092	71
1.31	ENST00000367053	31	ENSE00001674858	chr1:207753585-207753761	177	CR1_HUMAN	1196-1255	60	0	-	-
1.32	ENST00000367053	32	ENSE00001628329	chr1:207753856-207753958	103	CR1_HUMAN	1255-1289	35	0	-	-
1.33	ENST00000367053	33	ENSE00001800449	chr1:207755263-207755348	86	CR1_HUMAN	1289-1318	30	0	-	-
1.34	ENST00000367053	34	ENSE00001649667	chr1:207757994-207758221	228	CR1_HUMAN	1318-1394	77	0	-	-
1.35	ENST00000367053	35	ENSE00001443342	chr1:207760731-207760910	180	CR1_HUMAN	1394-1454	61	0	-	-
1.36	ENST00000367053	36	ENSE00001443341	chr1:207762020-207762119	100	CR1_HUMAN	1454-1487	34	0	-	-
1.37	ENST00000367053	37	ENSE00001443339	chr1:207780596-207780681	86	CR1_HUMAN	1487-1516	30	0	-	-
1.38b	ENST00000367053	38b	ENSE00001443338	chr1:207782635-207783033	399	CR1_HUMAN	1516-1649	134	0	-	-
1.39	ENST00000367053	39	ENSE00001665886	chr1:207785022-207785198	177	CR1_HUMAN	1649-1708	60	0	-	-
1.40	ENST00000367053	40	ENSE00001722915	chr1:207785284-207785386	103	CR1_HUMAN	1708-1742	35	0	-	-
1.41	ENST00000367053	41	ENSE00001687254	chr1:207787749-207787834	86	CR1_HUMAN	1742-1771	30	0	-	-
1.42	ENST00000367053	42	ENSE00001650414	chr1:207789920-207790147	228	CR1_HUMAN	1771-1847	77	0	-	-
1.43	ENST00000367053	43	ENSE00001443333	chr1:207791416-207791592	177	CR1_HUMAN	1847-1906	60	0	-	-
1.44	ENST00000367053	44	ENSE00001443332	chr1:207793225-207793410	186	CR1_HUMAN	1906-1968	63	0	-	-
1.45	ENST00000367053	45	ENSE00001648710	chr1:207795318-207795341	24	CR1_HUMAN	1968-1976	9	0	-	-
1.46	ENST00000367053	46	ENSE00001443330	chr1:207796338-207796413	76	CR1_HUMAN	1976-2001	26	0	-	-
1.47a	ENST00000367053	47a	ENSE00001443329	chr1:207803862-207803966	105	CR1_HUMAN	2001-2036	36	0	-	-
1.48c	ENST00000367053	48c	ENSE00001443328	chr1:207812742-207813992	1251	CR1_HUMAN	2036-2039	4	0	-	-

Theoretical Model

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:192
 aligned with CR1_HUMAN | P17927 from UniProtKB/Swiss-Prot  Length:2039

    Alignment length:192
                                   951       961       971       981       991      1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131  
           CR1_HUMAN    942 HCQAPDHFLFAKLKTQTNASDFPIGTSLKYECRPEYYGRPFSITCLDNLVWSSPKDVCKRKSCKTPPDPVNGMVHVITDIQVGSRINYSCTTGHRLIGHSSAECILSGNTAHWSTKPPICQRIPCGLPPTIANGDFISTNRENFHYGSVVTYRCNLGSRGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCI 1133
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..........eee.............eeeeee...ee...eeee..............ee.............ee.........eeee.....eeee....eeeee....eee.....eeee..........................eee..............ee...eee................ee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE SUSHI  PDB: - UniProt: 941-1001                             SUSHI  PDB: A:961-1022 UniProt: 1002-1063                     SUSHI  PDB: A:1023-1092 UniProt: 1064-1134                             PROSITE
           Transcript 1 (1) Exon 1.27  PDB: A:901-960 UniProt: 941-1001 [INCOMPLETE]    --------------------------------Exon 1.29  PDB: A:993-1022    ---------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------Exon 1.28a  PDB: A:960-993        ----------------------------Exon 1.30  PDB: A:1022-1092 UniProt: 1063-1196 [INCOMPLETE]             Transcript 1 (2)
                1gop A  901 HCQAPDHFLFAKLKTQTTASDFPIGTSLKYECRPEYYGRPFSITCLDNLVWSSPKDVCKRKSCKTPPDPVNGMVHVITDIQVGSRITYSCTTGHRLIGHSSAECILSGNTAHWSTKPPICQRIPCGLPPTIANGDFISTNRENFHYGSVVTYRCNLGSRGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCI 1092
                                   910       920       930       940       950       960       970       980       990      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 1GOP)

(no "CATH Domain" information available for 1GOP)

(no "Pfam Domain" information available for 1GOP)

Theoretical Model(hide GO term definitions)

Chain A (CR1_HUMAN | P17927)

molecular function
	GO:0001851	complement component C3b binding	Interacting selectively and non-covalently with the C3b product of the complement cascade.
	GO:0004877	complement component C3b receptor activity	Combining with the C3b product of the complement cascade and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0001855	complement component C4b binding	Interacting selectively and non-covalently with the C4b product of the classical complement cascade.
	GO:0001861	complement component C4b receptor activity	Combining with the C4b product of the classical complement cascade and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0001618	virus receptor activity	Combining with a virus component and mediating entry of the virus into the cell.
biological process
	GO:0006958	complement activation, classical pathway	Any process involved in the activation of any of the steps of the classical pathway of the complement cascade which allows for the direct killing of microbes, the disposal of immune complexes, and the regulation of other immune processes.
	GO:0002430	complement receptor mediated signaling pathway	A series of molecular signals generated as a consequence of a component of the complement pathway binding to a complement receptor. Such components include both whole complement proteins and fragments of complement proteins generated through the activity of the complement pathway.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0045087	innate immune response	Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
	GO:0045957	negative regulation of complement activation, alternative pathway	Any process that stops, prevents, or reduces the frequency, rate or extent of complement activation by the alternative pathway.
	GO:0045959	negative regulation of complement activation, classical pathway	Any process that stops, prevents, or reduces the frequency, rate or extent of complement activation by the classical pathway.
	GO:1900004	negative regulation of serine-type endopeptidase activity	Any process that stops, prevents or reduces the frequency, rate or extent of serine-type endopeptidase activity.
	GO:1900005	positive regulation of serine-type endopeptidase activity	Any process that activates or increases the frequency, rate or extent of serine-type endopeptidase activity.
	GO:0030449	regulation of complement activation	Any process that modulates the frequency, rate or extent of complement activation.
	GO:0046718	viral entry into host cell	The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Theoretical Model
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1gop)

	Sites
(no "Sites" information available for 1gop)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1gop)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Theoretical Model PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1gop
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CR1_HUMAN \| P17927
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CR1_HUMAN \| P17927
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	CR1_HUMAN \| P17927	:	1gkg 1gkn 1ppq 2mcy 2mcz 2q7z 5fo9

1gkg	STRUCTURE DETERMINATION AND RATIONAL MUTAGENESIS REVEAL BINDING SURFACE OF IMMUNE ADHERENCE RECEPTOR, CR1 (CD35)
1gkn	STRUCTURE DETERMINATION AND RATIONAL MUTAGENESIS REVEAL BINDING SURFACE OF IMMUNE ADHERENCE RECEPTOR, CR1 (CD35)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (6, 6)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (4, 4)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (22, 22)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File