Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF AVIAN ATIC, A BIFUNCTIONAL TRANSFORMYLASE AND CYCLOHYDROLASE ENZYME IN PURINE BIOSYNTHESIS AT 1.75 ANG. RESOLUTION
 
Authors :  S. E. Greasley, P. Horton, G. P. Beardsley, S. J. Benkovic, I. A. Wilson
Date :  17 Nov 00  (Deposition) - 27 Apr 01  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.75
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Homodimer, 2 Functional Domains; Impch Domain = Alpha/Beta/Alpha; Aicar Tfase = 2 Alpha/Beta/Alpha Domains, 1 Alpha + Beta Domain, Transferase, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. E. Greasley, P. Horton, J. Ramcharan, G. P. Beardsley, S. J. Benkovic, I. A. Wilson
Crystal Structure Of A Bifunctional Transformylase And Cyclohydrolase Enzyme In Purine Biosynthesis.
Nat. Struct. Biol. V. 8 402 2001
PubMed-ID: 11323713  |  Reference-DOI: 10.1038/87555
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - AICAR TRANSFORMYLASE-IMP CYCLOHYDROLASE
    Chains: A, B
    EC Number: 2.1.2.3, 3.5.4.10
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET 28A
    Expression System Strain: B834(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: AMINOIMIDAZOLE CARBOXAMIDE RIBONUCLEOTIDE TRANSFORMYLASE - INOSINE MONOPHOSPHATE CYCLOHYDROLASE
    Gene: PURH
    Mutation: YES
    Organism Common: CHICKEN
    Organism Scientific: GALLUS GALLUS
    Organism Taxid: 9031
    Synonym: BIFUNCTIONAL PURINE BIOSYNTHESIS PROTEIN PURH [INCLUDES PHOSPHORIBOSYLAMINOIMIDAZOLECARBOXAMIDE FORMYLTRANSFERASE (AICAR TRANSFORMYLASE) AND IMP CYCLOHYDROLASE (INOSINICASE, IMP SYNTHETASE, ATIC)]

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 23)

Asymmetric/Biological Unit (3, 23)
No.NameCountTypeFull Name
1G1Ligand/IonGUANOSINE-5'-MONOPHOSPHATE
2K2Ligand/IonPOTASSIUM ION
3MSE20Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREVAL A:426 , THR A:429 , SER A:431 , SER A:433 , ASP A:540 , LEU A:590BINDING SITE FOR RESIDUE K A 1001
2AC2SOFTWAREVAL B:426 , THR B:429 , SER B:431 , SER B:433 , ASP B:540 , LEU B:590 , HIS B:592BINDING SITE FOR RESIDUE K B 1002
3AC3SOFTWARESER A:11 , VAL A:12 , SER A:13 , LYS A:15 , SER A:35 , GLY A:37 , THR A:38 , GLY A:64 , ARG A:65 , LYS A:67 , THR A:68 , LEU A:69 , CYS A:102 , ASN A:103 , LEU A:104 , TYR A:105 , ASP A:126 , ILE A:127 , GLY A:128 , GLY A:129 , HOH A:2036 , HOH A:2066 , HOH A:2247BINDING SITE FOR RESIDUE G A 2001

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1G8M)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Ser A:216 -Pro A:217
2Ser A:431 -Asn A:432
3Ser B:216 -Pro B:217
4Ser B:431 -Asn B:432

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1G8M)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1G8M)

(-) Exons   (0, 0)

(no "Exon" information available for 1G8M)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:590
 aligned with PUR9_CHICK | P31335 from UniProtKB/Swiss-Prot  Length:593

    Alignment length:590
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553       563       573       583       593
           PUR9_CHICK     4 RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH 593
               SCOP domains d1g8ma1 A:4-200 IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC                                                                                                            d1g8ma2 A:201-593 AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC                                                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains 1g8mA04 A:4-190  [code=3.40.50.1380, no name defined]                                                                                                                                      -------------------------------------1g8mA03 A:228-374  [code=3.40.140.20, no name defined]                                                                                             1g8mA02 A:375-476,A:520-593  [code=3.40.140.20, no name defined]                                      -1g8mA01 A:478-519                         1g8mA02 A:375-476,A:520-593  [code=3.40.140.20, no name defined]           CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee....hhhhhhhhhhhh..eeeehhhhhhhhhhh....eehhhhhh....hhhh....hhhhhhhhhh..hhhhhhhhhhh....eeeeeee..hhhhhhh....hhhhhhh...hhhhhhhhhhhhh....eee.hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeee..........eeee.......eeeee...hhhhhhhhhhhhhhhhhhhhhhh..eeeeee..eeeeeee....hhhhhhhh....hhhhhhhhhhhhhhhhhh.......eeeee....hhhhhhhhhh..eeeeee...hhhhhhhhhhhhhhh.eeeee........eeeeee..eeeeee......hhhhhh.........hhhhhhhhhhhhhhhhh.....eeeee..eeeeee....hhhhhhhhhhhhhhhhhhh.hhhhhh.ee....hhhhhhhhhhhhhhh....hhhhhhhhh.eee.....hhhhhhhhhh....eeeee......hhhhhhhhh..eeeeeee....hhhhhhhhhhhhh.eeeee....... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1g8m A   4 RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEmLGGRVKTLHPAVHAGILARNIPEDNADmNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEmAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGmNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCmVHDLHKTLTPLASAYARSRGADRmSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQmDPNYEPDDNEIRTLYGLQLmQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSmKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAmFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH 593
                                    13        23        33        43        53       |63        73        83     |  93       103       113       123       133       143       153     | 163       173       183       193       203       213       223       233       243       253       263       273       283     | 293       303       313       323       333       343       353       363    |  373       383    |  393       403       413       423       433       443       453       463       473   |   483       493       503       513       523       533       543       553       563       573       583       593
                                                                                    61-MSE                      89-MSE                                                               159-MSE                                             211-MSE                                                                       289-MSE                 313-MSE                                                368-MSE             388-MSE                                                                                  477-MSE                            512-MSE                                                                             


Chain B from PDB  Type:PROTEIN  Length:590
 aligned with PUR9_CHICK | P31335 from UniProtKB/Swiss-Prot  Length:593

    Alignment length:590
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553       563       573       583       593
           PUR9_CHICK     4 RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH 593
               SCOP domains d1g8mb1 B:4-200 IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC                                                                                                            d1g8mb2 B:201-593 AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC                                                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains 1g8mB04 B:4-190  [code=3.40.50.1380, no name defined]                                                                                                                                      -------------------------------------1g8mB03 B:228-374  [code=3.40.140.20, no name defined]                                                                                             1g8mB02 B:375-476,B:520-583  [code=3.40.140.20, no name defined]                                      -1g8mB01 B:478-519                         1g8mB02 B:375-476,B:520-583  [code=3.40.140.20, no name defined]---------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee....hhhhhhhhhhhh..eeeehhhhhhhhhhh....eehhhhhh...hhhhh....hhhhhhhhhh..hhhhhhhhhhhh...eeeeeee..hhhhhh.....hhhhhhhh..hhhhhhhhhhhhh....eee.hhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeee..........eeee.......eeeee...hhhhhhhhhhhhhhhhhhhhhhh..eeeeee..eeeeeee....hhhhhhhh....hhhhhhhhhhhhhhhhhh.......eeeee....hhhhhhhhhh..eeeeee...hhhhhhhhhhhhhhh.eeeee........eeeeee..eeeeee......hhhhhh.........hhhhhhhhhhhhhhhhh.....eeeee..eeeeee....hhhhhhhhhhhhhhhhhhh.hhhhhh.......hhhhhhhhhhhhhhh....hhhhhhhhh.........hhhhhhhhhh....eeeee......hhhhhhhhh..eeeeeee....hhhhhhhhhhhhh.eeeee....... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1g8m B   4 RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEmLGGRVKTLHPAVHAGILARNIPEDNADmNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEmAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGmNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCmVHDLHKTLTPLASAYARSRGADRmSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQmDPNYEPDDNEIRTLYGLQLmQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSmKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAmFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH 593
                                    13        23        33        43        53       |63        73        83     |  93       103       113       123       133       143       153     | 163       173       183       193       203       213       223       233       243       253       263       273       283     | 293       303       313       323       333       343       353       363    |  373       383    |  393       403       413       423       433       443       453       463       473   |   483       493       503       513       523       533       543       553       563       573       583       593
                                                                                    61-MSE                      89-MSE                                                               159-MSE                                             211-MSE                                                                       289-MSE                 313-MSE                                                368-MSE             388-MSE                                                                                  477-MSE                            512-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (3, 8)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1G8M)

(-) Gene Ontology  (10, 10)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (PUR9_CHICK | P31335)
molecular function
    GO:0003937    IMP cyclohydrolase activity    Catalysis of the reaction: IMP + H2O = 5-formamido-1-(5-phosphoribosyl)imidazole-4-carboxamide.
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0004643    phosphoribosylaminoimidazolecarboxamide formyltransferase activity    Catalysis of the reaction: 10-formyltetrahydrofolate + 5'-phosphoribosyl-5-amino-4-imidazolecarboxamide = tetrahydrofolate + 5'-phosphoribosyl-5-formamido-4-imidazolecarboxamide.
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0006189    'de novo' IMP biosynthetic process    The chemical reactions and pathways resulting in the formation of IMP, inosine monophosphate, by the stepwise assembly of a purine ring on ribose 5-phosphate.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0006164    purine nucleotide biosynthetic process    The chemical reactions and pathways resulting in the formation of a purine nucleotide, a compound consisting of nucleoside (a purine base linked to a deoxyribose or ribose sugar) esterified with a phosphate group at either the 3' or 5'-hydroxyl group of the sugar.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    G  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    K  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ser A:216 - Pro A:217   [ RasMol ]  
    Ser A:431 - Asn A:432   [ RasMol ]  
    Ser B:216 - Pro B:217   [ RasMol ]  
    Ser B:431 - Asn B:432   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1g8m
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PUR9_CHICK | P31335
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.1.2.3
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
  3.5.4.10
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  PUR9_CHICK | P31335
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PUR9_CHICK | P31335: 1m9n 1oz0 1thz 2b1g 2b1i 2iu0 2iu3

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1G8M)